DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fa2h and AGMO

DIOPT Version :9

Sequence 1:NP_610279.3 Gene:fa2h / 35670 FlyBaseID:FBgn0050502 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_006715793.1 Gene:AGMO / 392636 HGNCID:33784 Length:456 Species:Homo sapiens


Alignment Length:315 Identity:55/315 - (17%)
Similarity:87/315 - (27%) Gaps:142/315 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 KPKSSQRETLHHDEDGTLRQRP-------------RETEDKNNNQVDDSMEHLVDWSKAMLPQI- 130
            ||..:..:||....|...:..|             ...:.|...::||::..:.....:.||.: 
Human    24 KPSETSFQTLEEVPDYVKKATPFFISLMLLELVVSWILKGKPPGRLDDALTSISAGVLSRLPSLF 88

  Fly   131 ---ANITDCYDEWVHKPVDRPLRLFD-PWYLEMCTKTPWWLVPLFWIPVIVKCAVEEFTTAWQDS 191
               ..:|.....|.:      .|||: ||      .:||                     .|. |
Human    89 FRSIELTSYIYIWEN------YRLFNLPW------DSPW---------------------TWY-S 119

  Fly   192 NQLAVFSGYFLFGVLLWSFLEYTLHRWVFHVKLSNKSGSWLCTFHFMIHGLHHK----------- 245
            ..|.|..||:.|            ||....|.:     .|..      |..||.           
Human   120 AFLGVDFGYYWF------------HRMAHEVNI-----MWAG------HQTHHSSEDYNLSTALR 161

  Fly   246 ----------VPFDPMRLVFPPLPGAVLAAV-------IYT-------PLSFVLSHPRVILSGAL 286
                      :.:.|:.|..||...||....       |:|       ||..:|:.|        
Human   162 QSVLQIYTSWIFYSPLALFIPPSVYAVHLQFNLLYQFWIHTEVINNLGPLELILNTP-------- 218

  Fly   287 AGYLCYDMMHYYLHYGNPSLWAFVHMKRYHHHHHFSHQTLGYGISSPLWDVVFKT 341
                    .|:.:|:|.         .||....:::...:       :||.:|.|
Human   219 --------SHHRVHHGR---------NRYCIDKNYAGVLI-------IWDKIFGT 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fa2hNP_610279.3 Cyt-b5 6..73 CDD:278597
FA_hydroxylase 117..341 CDD:294712 45/263 (17%)
AGMOXP_006715793.1 ERG3 43..255 CDD:225546 50/296 (17%)
FA_hydroxylase 120..249 CDD:282034 32/183 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.