DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fa2h and Cyt-b5

DIOPT Version :9

Sequence 1:NP_610279.3 Gene:fa2h / 35670 FlyBaseID:FBgn0050502 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster


Alignment Length:93 Identity:25/93 - (26%)
Similarity:43/93 - (46%) Gaps:4/93 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DIPKEAESNDKFIVKYRQQYYDLSRFMHKHPGGINTLKGLNSGDMTARFLKAPPHSDAAMYLMRE 70
            ::.|...:.|.::: .....||::.|:::||||...|......|.|..| :...||:.|..:|::
  Fly    13 EVAKHNTNKDTWLL-IHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENF-EDVGHSNDARDMMKK 75

  Fly    71 YKIDP--EDSRKPKSSQRETLHHDEDGT 96
            |||..  |..|...:.:.|.....|..|
  Fly    76 YKIGELVESERTSVAQKSEPTWSTEQQT 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fa2hNP_610279.3 Cyt-b5 6..73 CDD:278597 18/66 (27%)
FA_hydroxylase 117..341 CDD:294712
Cyt-b5NP_610294.1 Cyt-b5 8..81 CDD:278597 20/69 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R279
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.