DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fa2h and ch25hl1.1

DIOPT Version :9

Sequence 1:NP_610279.3 Gene:fa2h / 35670 FlyBaseID:FBgn0050502 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001017865.1 Gene:ch25hl1.1 / 336673 ZFINID:ZDB-GENE-030131-8617 Length:282 Species:Danio rerio


Alignment Length:228 Identity:46/228 - (20%)
Similarity:69/228 - (30%) Gaps:115/228 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 LVPLFWIPVIVKCAVEEFTTAWQDSNQLAVFSG-----------YFLFGVLLWSFLEYT---LHR 217
            ::|:..:|.:.       .|.|:      :|||           ||     ||..:.:.   |:|
Zfish   110 VMPMPPLPTVA-------PTVWE------MFSGGLGALLVFDTQYF-----LWHMVHHKNPHLYR 156

  Fly   218 WVFHVKLSNKSGSWLCTFHFMIHGLHHKV--PF---------------------DPMRLVFPPLP 259
            ||                    |.:||..  ||                     ||:.|...|| 
Zfish   157 WV--------------------HAIHHDYISPFSWSTQHLSGVELMTVGFWSNIDPILLKCHPL- 200

  Fly   260 GAVLAAVIYT-----------PLSFVLSHPRVILSGALAGYLCYDMMHYYLHYGNPSLWAFVHMK 313
             .|....:|:           .|.|...|  ::..|.|.|.:.:||     |:..||        
Zfish   201 -TVWTLTVYSIWMSVEDHIGYDLPFSPGH--LVPFGLLGGAMAHDM-----HHQKPS-------- 249

  Fly   314 RYHHHHHFSHQTLGYGISSPLWDVVFKTRIHLR 346
             .:....|||           ||.:|.|.|.::
Zfish   250 -SNFAPFFSH-----------WDKIFGTAITVK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fa2hNP_610279.3 Cyt-b5 6..73 CDD:278597
FA_hydroxylase 117..341 CDD:294712 44/221 (20%)
ch25hl1.1NP_001017865.1 ERG3 28..267 CDD:225546 45/223 (20%)
FA_hydroxylase 131..265 CDD:282034 37/187 (20%)
Histidine box-1 144..148 1/3 (33%)
Histidine box-2 159..163 1/3 (33%)
Histidine box-3 240..246 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.