DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fa2h and CG11162

DIOPT Version :9

Sequence 1:NP_610279.3 Gene:fa2h / 35670 FlyBaseID:FBgn0050502 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_572910.1 Gene:CG11162 / 32325 FlyBaseID:FBgn0030509 Length:278 Species:Drosophila melanogaster


Alignment Length:198 Identity:41/198 - (20%)
Similarity:74/198 - (37%) Gaps:38/198 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 DRPLRLFDPWYLEMCTKTPWWLVPLFWIPVI---VKCAVEEFTTAWQDSNQLAVFSGY------F 201
            :.|:.|...|:...        |.||.:.|:   |...|.||....::|..:.|...:      .
  Fly    75 NEPVNLAKLWHAVK--------VVLFNLTVVNFLVSWVVYEFVYKSENSQDIRVLPTFKRSLRDL 131

  Fly   202 LFGVLLWSFLEYTLHRWVFHVKLSNKSGSWLCTFHFMIHGLHHK--VPFDPMRLVFPPLPGAVLA 264
            :..|:|...:.|..||.:.|..:           :..:|..||:  .|...:.|...|:. .|||
  Fly   132 VVFVVLEEIMFYYAHRLLHHRSV-----------YKYVHKKHHEWTAPIAAITLYAHPVE-HVLA 184

  Fly   265 AVIYTPLSFVLSHPRVILSGALAGYLCYDMMHYYLHYGNPSLWAFVHMKRYHHHHH----FSHQT 325
            .::....|..:....|.|:..:......:.|..:..|..|  |: ....|:|.:||    :::..
  Fly   185 NLLPVATSIAILGTHVALAYVIFALAIINSMSDHTGYSFP--WS-AGSVRFHDYHHAKFNYNYGV 246

  Fly   326 LGY 328
            ||:
  Fly   247 LGF 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fa2hNP_610279.3 Cyt-b5 6..73 CDD:278597
FA_hydroxylase 117..341 CDD:294712 41/198 (21%)
CG11162NP_572910.1 ERG3 31..269 CDD:225546 41/198 (21%)
FA_hydroxylase 131..256 CDD:282034 28/134 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.