Sequence 1: | NP_610279.3 | Gene: | fa2h / 35670 | FlyBaseID: | FBgn0050502 | Length: | 355 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_848882.2 | Gene: | Agmo / 319660 | MGIID: | 2442495 | Length: | 447 | Species: | Mus musculus |
Alignment Length: | 202 | Identity: | 38/202 - (18%) |
---|---|---|---|
Similarity: | 60/202 - (29%) | Gaps: | 87/202 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 181 VEEFTTAWQDSNQL-----AVFSGYFLF-GVLLWSFLEYTLHRWVFHVKLSNKSGSWLCTFHFMI 239
Fly 240 HGLHHK---------------------VPFDPMRLVFPPLPGAV------------LAAVIYT-- 269
Fly 270 PLSFVLSHPRVILSGALAGYLCYDMMHYYLHYGNPSLWAFVHMKRYHHHHHFSHQTLGYGISSPL 334
Fly 335 WDVVFKT 341 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fa2h | NP_610279.3 | Cyt-b5 | 6..73 | CDD:278597 | |
FA_hydroxylase | 117..341 | CDD:294712 | 37/200 (19%) | ||
Agmo | NP_848882.2 | ERG3 | 43..256 | CDD:225546 | 38/202 (19%) |
FA_hydroxylase | 121..249 | CDD:282034 | 32/173 (18%) | ||
Histidine box-1 | 132..136 | 2/3 (67%) | |||
Histidine box-2 | 145..149 | 1/3 (33%) | |||
Histidine box-3 | 221..225 | 0/3 (0%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG3000 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |