DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fa2h and Agmo

DIOPT Version :9

Sequence 1:NP_610279.3 Gene:fa2h / 35670 FlyBaseID:FBgn0050502 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_848882.2 Gene:Agmo / 319660 MGIID:2442495 Length:447 Species:Mus musculus


Alignment Length:202 Identity:38/202 - (18%)
Similarity:60/202 - (29%) Gaps:87/202 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 VEEFTTAWQDSNQL-----AVFSGYFLF-GVLLWSFLEYTLHRWVFHVKLSNKSGSWLCTFHFMI 239
            |..:...|::...|     :.::.||.| ||   .|..|..||....:.:     .|..      
Mouse    94 VTSYIYIWENYRLLELPWDSTWTWYFTFLGV---DFGYYWFHRMAHEINI-----FWAA------ 144

  Fly   240 HGLHHK---------------------VPFDPMRLVFPPLPGAV------------LAAVIYT-- 269
            |..||.                     |.:.|:.|..||...||            ...:|.|  
Mouse   145 HQAHHSSEDYNLSTALRQSVLQQYSSWVFYCPLALFIPPSVFAVHIQFNLLYQFWIHTEIIRTLG 209

  Fly   270 PLSFVLSHPRVILSGALAGYLCYDMMHYYLHYGNPSLWAFVHMKRYHHHHHFSHQTLGYGISSPL 334
            ||..:|:.|                .|:.:|:|.         .||....:::...:       :
Mouse   210 PLEVILNTP----------------SHHRVHHGR---------NRYCIDKNYAGTLI-------I 242

  Fly   335 WDVVFKT 341
            ||.:|.|
Mouse   243 WDRIFGT 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fa2hNP_610279.3 Cyt-b5 6..73 CDD:278597
FA_hydroxylase 117..341 CDD:294712 37/200 (19%)
AgmoNP_848882.2 ERG3 43..256 CDD:225546 38/202 (19%)
FA_hydroxylase 121..249 CDD:282034 32/173 (18%)
Histidine box-1 132..136 2/3 (67%)
Histidine box-2 145..149 1/3 (33%)
Histidine box-3 221..225 0/3 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.