DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fa2h and cytb-5.2

DIOPT Version :9

Sequence 1:NP_610279.3 Gene:fa2h / 35670 FlyBaseID:FBgn0050502 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001379864.1 Gene:cytb-5.2 / 172393 WormBaseID:WBGene00020931 Length:141 Species:Caenorhabditis elegans


Alignment Length:107 Identity:31/107 - (28%)
Similarity:51/107 - (47%) Gaps:18/107 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YDLSRFMHKHPGGINTLKGLNSGDMTARFLKAPPHSDAAMYLMREYKID--PEDSRKPKSSQRET 88
            ||:::|:::||||...:..|...|.|..||.. .||..|:.:..||.|.  || |..||..    
 Worm    33 YDVTKFLNEHPGGEEVITQLAGKDATVGFLDV-GHSKDAIEMANEYLIGQLPE-SDVPKVE---- 91

  Fly    89 LHHDEDGTLRQRPRETEDKNNNQVDDSMEHLVD--WSKAMLP 128
                   |...:|.:.| |:::.::|..|.:..  |:..::|
 Worm    92 -------TAAAKPSKNE-KSSSLLNDFTEIMTSPTWTNFLIP 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fa2hNP_610279.3 Cyt-b5 6..73 CDD:278597 17/46 (37%)
FA_hydroxylase 117..341 CDD:294712 3/14 (21%)
cytb-5.2NP_001379864.1 Cyt-b5 8..82 CDD:395121 18/49 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R279
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.