DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fa2h and Msmo1

DIOPT Version :9

Sequence 1:NP_610279.3 Gene:fa2h / 35670 FlyBaseID:FBgn0050502 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_543162.1 Gene:Msmo1 / 140910 RGDID:620281 Length:293 Species:Rattus norvegicus


Alignment Length:306 Identity:60/306 - (19%)
Similarity:99/306 - (32%) Gaps:128/306 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 VDWSKAMLPQIANITDCYDEWVHKPVDRPLRLFDPWYLEMCTK---TPW------------WLVP 169
            ||:..::||:             .|:..|.:....:.|:..||   ..|            :.:|
  Rat    17 VDYVDSLLPE-------------NPLQEPFKNAWVYMLDNYTKFQIATWGSLIVHETIYFLFSLP 68

  Fly   170 LF---WIPVIVKCAV-----EEFTTAWQDSNQLAVFSGYFLFGVLL---WSFLEY--------TL 215
            .|   :||.:.|..:     |.|...|:....: :|:.:|:...|:   :.|.|:        .:
  Rat    69 GFLFQFIPFMRKYKIQKDKPETFEGQWKCLKGI-LFNHFFIQLPLICGTYYFTEFFNIPYDWERM 132

  Fly   216 HRWVFHVKLSNKSGSWLC-----TFHFMIHG-LHHK--------------VPFDPMRLVFPPLPG 260
            .||.|  .|:...|   |     |:|:.:|. ||||              .||........||..
  Rat   133 PRWYF--TLARCLG---CAVIEDTWHYFLHRLLHHKRIYKYIHKVHHEFQAPFGIEAEYAHPLET 192

  Fly   261 AVLAAVIYTPLSFVLSHPRVILSGALAGYLCYDMMHYYLHYGNPSLWAFVHMK------------ 313
            .:|....:..:..:..|  |||                       |||:|.|:            
  Rat   193 LILGTGFFIGIVLLCDH--VIL-----------------------LWAWVTMRLLETIDVHSGYD 232

  Fly   314 ---------------RYHHHHHFSHQTLG-YGISSPLWDVVFKTRI 343
                           |:|..||.:.  :| |..:...||.:|.|.:
  Rat   233 IPLNPLNYIPFYTGARHHDFHHMNF--IGNYASTFTWWDRIFGTDV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fa2hNP_610279.3 Cyt-b5 6..73 CDD:278597
FA_hydroxylase 117..341 CDD:294712 59/302 (20%)
Msmo1NP_543162.1 FA_hydroxylase 143..274 CDD:397991 32/160 (20%)
Histidine box-1 157..161 1/3 (33%)
Histidine box-2 170..174 0/3 (0%)
Histidine box-3 249..255 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.