Sequence 1: | NP_610279.3 | Gene: | fa2h / 35670 | FlyBaseID: | FBgn0050502 | Length: | 355 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_446094.1 | Gene: | Sc5d / 114100 | RGDID: | 620775 | Length: | 299 | Species: | Rattus norvegicus |
Alignment Length: | 204 | Identity: | 47/204 - (23%) |
---|---|---|---|
Similarity: | 73/204 - (35%) | Gaps: | 71/204 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 164 PWWLVP---LF--------------------WIPVIVKCAVEEFTTAWQDSNQLAVFSGYFLFGV 205
Fly 206 LLWSFLEYTLHRWVFHVKLSNKSGSWLCTFHFMIHGLHH--KVPFDPMRLVFPPLPGAVLAAVIY 268
Fly 269 TPLSFVLSHPRVILSGALAGYLCYDMMHYYLHYGN---PSLW-AFVHMKRYHHHHH--FSHQTLG 327
Fly 328 YGISSPLWD 336 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fa2h | NP_610279.3 | Cyt-b5 | 6..73 | CDD:278597 | |
FA_hydroxylase | 117..341 | CDD:294712 | 47/204 (23%) | ||
Sc5d | NP_446094.1 | ERG3 | 40..257 | CDD:225546 | 47/204 (23%) |
Histidine box-1 | 138..143 | 2/4 (50%) | |||
Histidine box-2 | 151..155 | 1/3 (33%) | |||
Histidine box-3 | 228..233 | 1/4 (25%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG3000 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |