Sequence 1: | NP_610279.3 | Gene: | fa2h / 35670 | FlyBaseID: | FBgn0050502 | Length: | 355 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_115761.2 | Gene: | FAXDC2 / 10826 | HGNCID: | 1334 | Length: | 333 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 49/205 - (23%) |
---|---|---|---|
Similarity: | 78/205 - (38%) | Gaps: | 41/205 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 153 DPWYLEMCTKTPWWLVPLFWIPVIVKCAVEEFTTAWQD--SNQLAVFSGYFLFGVLLWSFLE--- 212
Fly 213 -YTLHRWVFHVKLSNKSGSWLCTFHFMIHGLHHK--VPFDPMRLVFPPLPGAV--LAAVIYTPLS 272
Fly 273 FVLSHPRVILSGALAGYLCYDMMH--YYLHYGNPSLWAFVHMKRYHHHHHFSHQTLGYGISSPL- 334
Fly 335 ----WDVVFK 340 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fa2h | NP_610279.3 | Cyt-b5 | 6..73 | CDD:278597 | |
FA_hydroxylase | 117..341 | CDD:294712 | 49/205 (24%) | ||
FAXDC2 | NP_115761.2 | FA_hydroxylase | 175..299 | CDD:309300 | 33/144 (23%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG3000 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |