DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fa2h and FAXDC2

DIOPT Version :9

Sequence 1:NP_610279.3 Gene:fa2h / 35670 FlyBaseID:FBgn0050502 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_115761.2 Gene:FAXDC2 / 10826 HGNCID:1334 Length:333 Species:Homo sapiens


Alignment Length:205 Identity:49/205 - (23%)
Similarity:78/205 - (38%) Gaps:41/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 DPWYLEMCTKTPWWLVPLFWIPVIVKCAVEEFTTAWQD--SNQLAVFSGYFLFGVLLWSFLE--- 212
            ||..|....:|..:...:...|::|  .:..|...|:|  ..:|..|. :||..:.:::.:|   
Human   124 DPVKLRQSIRTVLFNQCMISFPMVV--FLYPFLKWWRDPCRRELPTFH-WFLLELAIFTLIEEVL 185

  Fly   213 -YTLHRWVFHVKLSNKSGSWLCTFHFMIHGLHHK--VPFDPMRLVFPPLPGAV--LAAVIYTPLS 272
             |..||.:.|.           ||:..||..||:  .|...:.|...|:..||  :..||..|| 
Human   186 FYYSHRLLHHP-----------TFYKKIHKKHHEWTAPIGVISLYAHPIEHAVSNMLPVIVGPL- 238

  Fly   273 FVLSHPRVILSGALAGYLCYDMMH--YYLHYGNPSLWAFVHMKRYHHHHHFSHQTLGYGISSPL- 334
            .:.||...|........:...:.|  |:|        .|:....:|.:||...... ||:...| 
Human   239 VMGSHLSSITMWFSLALIITTISHCGYHL--------PFLPSPEFHDYHHLKFNQC-YGVLGVLD 294

  Fly   335 ----WDVVFK 340
                .|.:||
Human   295 HLHGTDTMFK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fa2hNP_610279.3 Cyt-b5 6..73 CDD:278597
FA_hydroxylase 117..341 CDD:294712 49/205 (24%)
FAXDC2NP_115761.2 FA_hydroxylase 175..299 CDD:309300 33/144 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.