DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11125 and ENKD1

DIOPT Version :9

Sequence 1:NP_001260771.1 Gene:CG11125 / 35669 FlyBaseID:FBgn0033174 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_115516.1 Gene:ENKD1 / 84080 HGNCID:25246 Length:346 Species:Homo sapiens


Alignment Length:393 Identity:93/393 - (23%)
Similarity:146/393 - (37%) Gaps:114/393 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KLAAKEPTRPKWMPP-LRRSSSVMGDSKAEKPAAKGKTIKQNSLQNGRSTSRSQHQLAVAVPAEG 108
            :::...|..|...|. .||.:|..|       ..:|..:|.:.|.:.|:                
Human     7 RISGPIPPDPTLCPDNYRRPTSAQG-------RLEGNALKLDLLTSDRA---------------- 48

  Fly   109 ERFDGLEERNPILYDPSENLESENLQEPSSDTDIDRCQSCGTNRSSTSIAIQTEDITDELYLTNA 173
              .|....|.|.:             .|.:...::|.|     |....:.:|.|.|:  |....:
Human    49 --LDTTAPRGPCI-------------GPGAGEILERGQ-----RGVGDVLLQLEGIS--LGPGAS 91

  Fly   174 LKKCNFDARSILEESGAKYGENYKPMQYENEEDLEQ---LPLSARSNSSK----QSRFNMSEMEA 231
            ||:  .|.:...:|:..:..|..|..: |.|...||   .||.|...|.|    :||......|.
Human    92 LKR--KDPKDHEKENLRRIREIQKRFR-EQERSREQGQPRPLKALWRSPKYDKVESRVKAQLQEP 153

  Fly   232 MPMTEAEPANYGASDDEAPLSARSRFTTASNVTTISSKS------KRREHKLG-------SRDEV 283
            .|.:..|.|::        |.|.||.........:||..      :.:|..||       :|...
Human   154 GPASGTESAHF--------LRAHSRCGPGLPPPHVSSPQPTPPGPEAKEPGLGVDFIRHNARAAK 210

  Fly   284 RLPR-----------YLEKQK-------------------------REKAVAKQLAESLDPDCPR 312
            |.||           .||:|:                         |.:|.|::.::. ||..|.
Human   211 RAPRRHSCSLQVLAQVLEQQRQAQEHYNATQKGHVPHYLLERRDLWRREAEARKQSQP-DPAMPP 274

  Fly   313 GHVLLSDQDRLTHLTNAKKRYEQLVNELNHMPMTAQTLRVRNRKAEIDKELTTVEEDIRIYSKAK 377
            ||..:.:..||..||...:...||:.||..:|..|.:||.::.:||:|::|..|||.|:|:|:.|
Human   275 GHTRMPENQRLETLTKLLQSQSQLLRELVLLPAGADSLRAQSHRAELDRKLVQVEEAIKIFSRPK 339

  Fly   378 VFV 380
            |||
Human   340 VFV 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11125NP_001260771.1 Enkurin 284..375 CDD:290575 35/126 (28%)
ENKD1NP_115516.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 7/34 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..137 7/23 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..197 6/29 (21%)
Enkurin 243..337 CDD:316387 29/94 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..280 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159749
Domainoid 1 1.000 59 1.000 Domainoid score I10750
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1383928at2759
OrthoFinder 1 1.000 - - FOG0009640
OrthoInspector 1 1.000 - - oto90542
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21490
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5083
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
99.030

Return to query results.
Submit another query.