DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11125 and CG16984

DIOPT Version :9

Sequence 1:NP_001260771.1 Gene:CG11125 / 35669 FlyBaseID:FBgn0033174 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_647729.1 Gene:CG16984 / 38322 FlyBaseID:FBgn0062517 Length:307 Species:Drosophila melanogaster


Alignment Length:292 Identity:52/292 - (17%)
Similarity:92/292 - (31%) Gaps:97/292 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 KKCNFDARSILEESGAKYGENYKPMQYENEED--------------LEQLPLSA----------- 214
            |:..|..::.:.|..|||.:..:  :..||||              |.:...||           
  Fly    27 KESIFVYKNPVVERAAKYAKRLR--ERFNEEDKKLSIILQNDGTRVLTEAKKSAHRTMGCAHTPI 89

  Fly   215 --------RSNSSKQSRFNMSEMEAM-PMTEAEPANYGASDD----------------------- 247
                    :|...|..|.|..:...| ||....|...|....                       
  Fly    90 DPPCAYLRKSQGIKWRRENTHKCPKMPPMPPLPPPGSGGKKPAMVPNFIKRNKICAGQTVPCPPP 154

  Fly   248 ----EAPLSARSRFTTASNVTTISSKSKRREHKLGSRDEVRLPRYLEKQKREKA-----VAKQLA 303
                :.|:.||.....:..|.....:          :|..::|.||:|.||..|     .||:.|
  Fly   155 PRYVDTPVGARHDLLNSGLVPQFICR----------KDFGKVPVYLKKTKRMLADMNAVCAKEQA 209

  Fly   304 ESLD------------------PDCPRGHVLLSDQDRLTHLTNAKKRYEQLVNELNHMPMTAQTL 350
            ..|:                  |..| |..::...:|...|...:....::..:...|.:...::
  Fly   210 RLLELCRGIKGFTRASVQSSGPPPMP-GMRVMEQAERNEILEGLRLSLTEMTKQYQSMSLLIDSI 273

  Fly   351 RVRNRKAEIDKELTTVEEDIRIYSKAKVFVLA 382
            ..|.||::::.:|..||:||.:.....:..::
  Fly   274 AKRQRKSKLESDLRQVEQDILLIETTPIIYVS 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11125NP_001260771.1 Enkurin 284..375 CDD:290575 25/113 (22%)
CG16984NP_647729.1 Enkurin 184..297 CDD:290575 25/113 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470295
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21490
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.