DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11125 and CG32591

DIOPT Version :9

Sequence 1:NP_001260771.1 Gene:CG11125 / 35669 FlyBaseID:FBgn0033174 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001285256.1 Gene:CG32591 / 318104 FlyBaseID:FBgn0052591 Length:392 Species:Drosophila melanogaster


Alignment Length:422 Identity:102/422 - (24%)
Similarity:154/422 - (36%) Gaps:121/422 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RNFLKENKVSLRSLEKSTSQKLAAKEPTRPKWMP-----PLRRSSSVMGDSKAEKPAAKGKTIKQ 84
            |:||:|||.::..:|.:.....||.....|.|.|     |.:....|....:..:|         
  Fly    12 RDFLQENKQNVSRMETNGRCIAAANARRVPLWRPVVLHYPEKLRPHVYNIQRRTRP--------- 67

  Fly    85 NSLQNGRSTSRSQHQLAVAVPAEGERFDGLEER---NPILYDPS-----ENLESENLQEPSSDTD 141
              |.....:.|.:..||.......|    :..|   ||...|.:     |..|.|.||....|..
  Fly    68 --LHGAHESPRLRSGLAQPYGFHNE----MRRRMPPNPCGCDLTTRKTVERKEQERLQGGWEDQQ 126

  Fly   142 IDR--CQSCGTNRSSTSIAIQTEDITDELYLTNALKKCNFDARSILEESGAKYGENYKPMQYENE 204
            :.|  |..|..:..               |.||.....:..|:.:.:..| .:|:...|.|.:..
  Fly   127 VPRKCCSGCTCHHG---------------YPTNKPSDQDHQAKEVSQHQG-HHGQAVAPHQGQQS 175

  Fly   205 EDLEQLP-----------------LSARSNSSKQSRFNMSEMEAMPMTEAEPA-NYGASDDEAPL 251
            |...|:.                 :|..|.:|:.||.:.:. .|...:||:.. ..|.:|.||||
  Fly   176 ETDGQIQPKHGEGDQADRISVCSRMSQESRASRASRASRAS-RASRRSEAQSTQGQGNNDPEAPL 239

  Fly   252 SAR--------------------------------SRFTTASNVTTISSKSKRRE------HKLG 278
            |||                                ||.||||..:.:|.|||..|      |.  
  Fly   240 SARSSASTKTLKSKRSVSQESVRSNATIKSNITVASRSTTASKRSQVSRKSKLMEVMPPPTHL-- 302

  Fly   279 SRDEVRLPRYLEKQKREKAVAKQLAESLDPDCPRGHVLLSDQDRLTHLTNAKKRYEQLVNELNHM 343
               |.|.|:..||:|...|:             .|:..|:..:|...|.:|..:|.:||.|.|.|
  Fly   303 ---EDRRPKEREKEKAPTAI-------------EGYTPLTPSERQAALQDAHVKYSKLVEEYNRM 351

  Fly   344 PMTAQTLRVRNRKAEIDKELTTVEEDIRIYSK 375
            |::..||||||||..|:::|..::..|.::.:
  Fly   352 PVSEPTLRVRNRKIAIERQLDELDYAINMFDQ 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11125NP_001260771.1 Enkurin 284..375 CDD:290575 29/90 (32%)
CG32591NP_001285256.1 Enkurin <308..381 CDD:290575 27/85 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1383928at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21490
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.