DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaB-Ras and Nkiras2

DIOPT Version :9

Sequence 1:NP_001137613.1 Gene:kappaB-Ras / 35667 FlyBaseID:FBgn0040513 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_082300.1 Gene:Nkiras2 / 71966 MGIID:1919216 Length:191 Species:Mus musculus


Alignment Length:189 Identity:75/189 - (39%)
Similarity:114/189 - (60%) Gaps:10/189 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IGKVGKVLVCGMKGVGKTALIEQLVYGHVNPETELHPTIEDIYVASVDTGRGGARETLRIYDTAG 70
            :||..||:|||...||||:::|||:||:....:|:..|.|||||.|::|.| |.||.:|.|||.|
Mouse     1 MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDR-GVREQVRFYDTRG 64

  Fly    71 LQGEQQQLPRHYLQFPDAFVLVYDPMDPRSLDMLADIKADIEKHKEKKEIPVVVLAN---VRARA 132
            |: :..:||:|.....|.:||||......|...:..:|.:|:|.|:|||:.:|||.|   ::.:.
Mouse    65 LR-DGAELPKHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQR 128

  Fly   133 APNPVEKVMDRANIWCQRERIKHYTVNAMERPSLYEPFTTLCARLHPMQTKSTFPQLRQ 191
            ..:|     |.|..|.:.|::|.:.|:..:|.||.|||..|.:::...|:||.||..|:
Mouse   129 RVDP-----DVAQHWAKSEKVKLWEVSVADRRSLLEPFIYLASKMTQPQSKSAFPLSRK 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaB-RasNP_001137613.1 Ras 11..173 CDD:278499 66/164 (40%)
Ras_like_GTPase 13..174 CDD:206648 64/163 (39%)
Nkiras2NP_082300.1 Small GTPase-like 1..191 75/189 (40%)
P-loop_NTPase 6..168 CDD:422963 67/168 (40%)
Effector region 35..43 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..191 6/14 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5307
eggNOG 1 0.900 - - E1_KOG3883
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4455
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49065
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002909
OrthoInspector 1 1.000 - - otm42639
orthoMCL 1 0.900 - - OOG6_106084
Panther 1 1.100 - - O PTHR46152
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2273
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.