DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaB-Ras and nkiras2

DIOPT Version :9

Sequence 1:NP_001137613.1 Gene:kappaB-Ras / 35667 FlyBaseID:FBgn0040513 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001003433.1 Gene:nkiras2 / 445039 ZFINID:ZDB-GENE-040801-166 Length:192 Species:Danio rerio


Alignment Length:194 Identity:74/194 - (38%)
Similarity:117/194 - (60%) Gaps:8/194 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IGKVGKVLVCGMKGVGKTALIEQLVYGHVNPETELHPTIEDIYVASVDTGRGGARETLRIYDTAG 70
            :||..||:|||...|||||::|||:|.:....:|...|:||||:.||:|.| |.||.:|.|||.|
Zfish     1 MGKSCKVVVCGQGSVGKTAVLEQLLYANHVVGSETMETLEDIYIGSVETDR-GTREQVRFYDTRG 64

  Fly    71 LQGEQQQLPRHYLQFPDAFVLVYDPMDPRSLDMLADIKADIEKHKEKKEIPVVVLANVRARAAPN 135
            |: :.|:.||||..|.|.|||||......|...:..:|.:|::.::|||:.:||:.|........
Zfish    65 LR-DGQEFPRHYFTFADGFVLVYSIDSRESFKRVEALKKEIDRCRDKKEVTIVVVGNKLDLQDQR 128

  Fly   136 PVEKVMDRANIWCQRERIKHYTVNAMERPSLYEPFTTLCARLHPMQTKSTFPQLRQVMQNRQKS 199
            .|:.  ..|..|.::|:::.:.::..:|.:|.|||..|.:::...|:|||||    :.:|:.|:
Zfish   129 RVDS--SAAQQWARQEKVRLWEISVTDRRTLIEPFVHLASKMTQPQSKSTFP----LSRNKNKT 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaB-RasNP_001137613.1 Ras 11..173 CDD:278499 63/161 (39%)
Ras_like_GTPase 13..174 CDD:206648 61/160 (38%)
nkiras2NP_001003433.1 P-loop_NTPase 6..168 CDD:304359 64/165 (39%)
small_GTPase 6..164 CDD:197466 63/161 (39%)
Effector region 35..43 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..192 8/22 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5348
eggNOG 1 0.900 - - E1_KOG3883
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4490
OMA 1 1.010 - - QHG49065
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002909
OrthoInspector 1 1.000 - - otm25985
orthoMCL 1 0.900 - - OOG6_106084
Panther 1 1.100 - - O PTHR46152
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2273
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.