DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaB-Ras and CG8500

DIOPT Version :9

Sequence 1:NP_001137613.1 Gene:kappaB-Ras / 35667 FlyBaseID:FBgn0040513 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001303452.1 Gene:CG8500 / 41203 FlyBaseID:FBgn0037754 Length:233 Species:Drosophila melanogaster


Alignment Length:200 Identity:58/200 - (28%)
Similarity:91/200 - (45%) Gaps:27/200 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KVLVCGMKGVGKTALIEQLVYGHVNPETELHPTIEDIYVASVDTGRGGARETLRIYDTAGLQGEQ 75
            :|:|.|..||||::|:.:.:.|... |:.: |||||.|...:...:...  ||:|.||.|    .
  Fly    20 RVVVFGAGGVGKSSLVLRFIKGTFR-ESYI-PTIEDTYRQVISCNKNIC--TLQITDTTG----S 76

  Fly    76 QQLP---RHYLQFPDAFVLVYDPMDPRSLDMLADIKADIEKHK--EKKEIPVVVLANVRARAAPN 135
            .|.|   |..:....||:|||.....:||:.|..|.|.|::.|  :...|||:::.|.....|  
  Fly    77 HQFPAMQRLSISKGHAFILVYSVCSKQSLEELRPIWALIKELKGADIPNIPVMLVGNKCDETA-- 139

  Fly   136 PVEKVMD-----RANIWCQRERIKHYTVNAMERPSLYEPFTTLCARLHPMQTKSTFPQLRQVMQN 195
            .:.:|..     :|..|    .|.....:|....::.|.|..|   |:..:|::...||....|.
  Fly   140 ELREVSQAEGQAQATTW----SISFMETSAKTNHNVTELFQEL---LNMEKTRTVSLQLDTKKQK 197

  Fly   196 RQKSE 200
            :||.|
  Fly   198 KQKKE 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaB-RasNP_001137613.1 Ras 11..173 CDD:278499 49/171 (29%)
Ras_like_GTPase 13..174 CDD:206648 48/170 (28%)
CG8500NP_001303452.1 ARHI_like 18..183 CDD:206711 51/179 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453067
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.