DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaB-Ras and CG8519

DIOPT Version :9

Sequence 1:NP_001137613.1 Gene:kappaB-Ras / 35667 FlyBaseID:FBgn0040513 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster


Alignment Length:208 Identity:47/208 - (22%)
Similarity:77/208 - (37%) Gaps:39/208 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KVLVCGMKGVGKTALIEQLV-------YGHVNPETELHPTIEDIYVASVDTGRGGARETLRIYDT 68
            |:.|.|...|||:|||.:.:       |.|.......|..:.|           |......|.||
  Fly    17 KIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVD-----------GEPVLFEILDT 70

  Fly    69 AGLQGEQQQLPRHYLQFPDAFVLVYDPMDPRSLDMLADIKADIEKHKEKKEIPVVVLAN----VR 129
            .....::.......:|:.|..:|||...|.:|.:.:...|:|::     .:.||.:.||    |.
  Fly    71 CPKAEDEYPNAAELVQWADGLLLVYSITDRKSFNYIRRAKSDLQ-----SDTPVQLCANKVDMVH 130

  Fly   130 ARAAPNPVEKVMDRANIWCQRERIKHYTVNAMER-PSLYEPFTTLCARLHPMQTKSTFPQLRQVM 193
            .|....      |...|..:....|...|:|.:. ..:.|.|..||..:...:.||....|.:::
  Fly   131 LRQVSR------DEGEILAKDFECKFSEVSAADHVDQVAEVFNELCKEVLASKRKSKQSLLERML 189

  Fly   194 -----QNRQKSEA 201
                 .:|.||::
  Fly   190 GGARPYSRGKSDS 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaB-RasNP_001137613.1 Ras 11..173 CDD:278499 39/173 (23%)
Ras_like_GTPase 13..174 CDD:206648 38/172 (22%)
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 41/177 (23%)
P-loop_NTPase 17..173 CDD:304359 41/177 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452982
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.