DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaB-Ras and CG5160

DIOPT Version :9

Sequence 1:NP_001137613.1 Gene:kappaB-Ras / 35667 FlyBaseID:FBgn0040513 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster


Alignment Length:216 Identity:48/216 - (22%)
Similarity:88/216 - (40%) Gaps:59/216 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KIG------KVGKVLVCGMKGVGKTALIEQLVYGHVNPETELHPTIEDIYVASVDTGRGGARETL 63
            |:|      |..||:|.|..||||||::.:.:......|.:  |.:|.||.......    :|.:
  Fly    12 KLGLHTNKQKTLKVMVLGQSGVGKTAMVVRFITRRFIGEYD--PNLEKIYTCQTTLD----KEQI 70

  Fly    64 RIYDTAGLQGEQQQLP----RHYLQFPDAFVLVYDPMDPRSLDMLADIKADIEKHKEKK------ 118
            : :|.....|:.|:|.    ...:::.|||:|:|...|..|.|..:.:|..|..:|.::      
  Fly    71 Q-FDILDATGQLQELDGVSLESNIRWADAFILMYSITDKCSFDECSRLKFLINYNKRRRKLGSAS 134

  Fly   119 -----EIPVVVLANVRARAAPNPVEKVMDRANIWCQRERIKHYTVNAMERPSLYE---PFTTL-C 174
                 :|||:::.|    ....|.::::                       ||.|   .|..| |
  Fly   135 KEYALDIPVILVGN----KTDQPGDRMV-----------------------SLEEGQRRFRELSC 172

  Fly   175 ARLHPMQTKSTFPQLRQVMQN 195
            :..|.:..:.:..|::.|.::
  Fly   173 SCFHEISVRESVDQVQNVFRD 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaB-RasNP_001137613.1 Ras 11..173 CDD:278499 40/179 (22%)
Ras_like_GTPase 13..174 CDD:206648 39/179 (22%)
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 46/207 (22%)
RERG_RasL11_like 24..200 CDD:206713 45/204 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452995
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.