DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaB-Ras and Rala

DIOPT Version :9

Sequence 1:NP_001137613.1 Gene:kappaB-Ras / 35667 FlyBaseID:FBgn0040513 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster


Alignment Length:176 Identity:43/176 - (24%)
Similarity:77/176 - (43%) Gaps:9/176 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KVLVCGMKGVGKTALIEQLVYGHVNPETELHPTIEDIYVASVDTGRGGARETLRIYDTAGLQGEQ 75
            ||::.|..||||:||..|.:|.....:.|  ||..|.|...|..  .|....:.|.|||| |.:.
  Fly    13 KVIMVGSGGVGKSALTLQFMYDEFVEDYE--PTKADSYRKKVVL--DGEEVQIDILDTAG-QEDY 72

  Fly    76 QQLPRHYLQFPDAFVLVYDPMDPRSLDMLADIKADIEKHKEKKEIPVVVLANVRARAAPNPVEKV 140
            ..:..:|.:..:.|:.|:...|..|.....:.:..|.:.|..:.||.:::.|   :...|...||
  Fly    73 AAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGN---KCDLNDKRKV 134

  Fly   141 -MDRANIWCQRERIKHYTVNAMERPSLYEPFTTLCARLHPMQTKST 185
             :....:..|:..:.:...:|..|.::.:.|..|...:...:|:.:
  Fly   135 PLSECQLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTEDS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaB-RasNP_001137613.1 Ras 11..173 CDD:278499 41/162 (25%)
Ras_like_GTPase 13..174 CDD:206648 39/161 (24%)
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 42/168 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453045
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.