DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaB-Ras and CG13375

DIOPT Version :9

Sequence 1:NP_001137613.1 Gene:kappaB-Ras / 35667 FlyBaseID:FBgn0040513 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001162628.1 Gene:CG13375 / 30976 FlyBaseID:FBgn0040370 Length:306 Species:Drosophila melanogaster


Alignment Length:207 Identity:56/207 - (27%)
Similarity:88/207 - (42%) Gaps:48/207 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KVLVCGMKGVGKTALIEQLVYGHVNPETELHPTIEDIYVASVDTGRGGARETLRIYDTAGLQGEQ 75
            |::|.|...||||::|.|.:|...:  |:...|||:::..:...  .|...||.|.||||     
  Fly    49 KIVVMGSAKVGKTSIITQFLYNTFS--TKYKRTIEEMHQGNFSI--AGVSLTLDILDTAG----- 104

  Fly    76 QQLPRHYLQFP----------DAFVLVYDPMDPRSLDMLADIKADIEKHKEKKEIPVVVLANVRA 130
                  ..:||          |||:||||..|..:.:.:..|:..|.:.|....:|:||:.|...
  Fly   105 ------SYEFPAMRALSISSADAFILVYDVTDATTFEEVRTIRDQIHETKATTAVPIVVVGNKID 163

  Fly   131 RAAPNPVEKVMDRANIWCQRERIKHYTV---------NAMERPSLYEPFTTLCARLHPMQTKSTF 186
            ..|....|:.::.|.    .|.:  .||         :|....::.:.|..|.|     |.|.|:
  Fly   164 LLADGETEREVEYAT----TESV--VTVDWENGFVEASASSNENITQVFKELLA-----QAKITY 217

  Fly   187 ---PQLRQVMQN 195
               |.||:..|:
  Fly   218 NLSPALRRRRQS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaB-RasNP_001137613.1 Ras 11..173 CDD:278499 47/180 (26%)
Ras_like_GTPase 13..174 CDD:206648 46/179 (26%)
CG13375NP_001162628.1 RAS 48..215 CDD:214541 50/191 (26%)
Ras_dva 49..239 CDD:206714 56/207 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453065
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.