DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaB-Ras and Nkiras1

DIOPT Version :9

Sequence 1:NP_001137613.1 Gene:kappaB-Ras / 35667 FlyBaseID:FBgn0040513 Length:201 Species:Drosophila melanogaster
Sequence 2:XP_038949172.1 Gene:Nkiras1 / 305751 RGDID:1308560 Length:283 Species:Rattus norvegicus


Alignment Length:183 Identity:81/183 - (44%)
Similarity:116/183 - (63%) Gaps:4/183 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KIGKVGKVLVCGMKGVGKTALIEQLVYGHVNPETELHPTIEDIYVASVDTGRGGARETLRIYDTA 69
            |:||..||:|||:..|||||::|||:||:.....|...|:||:|:|||:|.| |.:|.|.:|||.
  Rat    91 KMGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETLEDVYMASVETDR-GVKEQLHLYDTR 154

  Fly    70 GLQGEQQQLPRHYLQFPDAFVLVYDPMDPRSLDMLADIKADIEKHKEKKEIPVVVLANVRARAAP 134
            ||| |..:||:||..|.|.|||||...:..|...:..:|.:|:|.|:|||:.:|||.|....:..
  Rat   155 GLQ-EGVELPKHYFSFADGFVLVYSVNNLESFQRVELLKKEIDKFKDKKEVAIVVLGNKLDLSEQ 218

  Fly   135 NPVEKVMDRANIWCQRERIKHYTVNAMERPSLYEPFTTLCARLHPMQTKSTFP 187
            ..|:  .|.|..|.:.|::|.:.|...:|.:|.||||.|.::|...|:||:||
  Rat   219 RQVD--ADAAQQWARSEKVKLWEVTVTDRRTLIEPFTLLASKLSQPQSKSSFP 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaB-RasNP_001137613.1 Ras 11..173 CDD:278499 71/161 (44%)
Ras_like_GTPase 13..174 CDD:206648 69/160 (43%)
Nkiras1XP_038949172.1 P-loop_NTPase 97..259 CDD:422963 72/165 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 131 1.000 Domainoid score I5028
eggNOG 1 0.900 - - E1_KOG3883
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10670
Inparanoid 1 1.050 144 1.000 Inparanoid score I4349
OMA 1 1.010 - - QHG49065
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002909
OrthoInspector 1 1.000 - - otm44706
orthoMCL 1 0.900 - - OOG6_106084
Panther 1 1.100 - - LDO PTHR46152
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2273
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.830

Return to query results.
Submit another query.