DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaB-Ras and NKIRAS1

DIOPT Version :9

Sequence 1:NP_001137613.1 Gene:kappaB-Ras / 35667 FlyBaseID:FBgn0040513 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001364280.1 Gene:NKIRAS1 / 28512 HGNCID:17899 Length:192 Species:Homo sapiens


Alignment Length:182 Identity:78/182 - (42%)
Similarity:115/182 - (63%) Gaps:4/182 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IGKVGKVLVCGMKGVGKTALIEQLVYGHVNPETELHPTIEDIYVASVDTGRGGARETLRIYDTAG 70
            :||..||:|||:..|||||::|||:||:.....|...|:||:|:|||:|.| |.:|.|.:|||.|
Human     1 MGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDVYMASVETDR-GVKEQLHLYDTRG 64

  Fly    71 LQGEQQQLPRHYLQFPDAFVLVYDPMDPRSLDMLADIKADIEKHKEKKEIPVVVLANVRARAAPN 135
            || |..:||:||..|.|.|||||...:..|...:..:|.:|:|.|:|||:.:|||.|....:...
Human    65 LQ-EGVELPKHYFSFADGFVLVYSVNNLESFQRVELLKKEIDKFKDKKEVAIVVLGNKIDLSEQR 128

  Fly   136 PVEKVMDRANIWCQRERIKHYTVNAMERPSLYEPFTTLCARLHPMQTKSTFP 187
            .|:  .:.|..|.:.|:::.:.|...:|.:|.||||.|.::|...|:||:||
Human   129 QVD--AEVAQQWAKSEKVRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSSFP 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaB-RasNP_001137613.1 Ras 11..173 CDD:278499 69/161 (43%)
Ras_like_GTPase 13..174 CDD:206648 67/160 (42%)
NKIRAS1NP_001364280.1 P-loop_NTPase 6..168 CDD:422963 70/165 (42%)
Effector region 35..43 3/7 (43%)
Interactions with NFKBIA and NFKBIB 58..93 18/35 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 168..192 6/11 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 127 1.000 Domainoid score I5371
eggNOG 1 0.900 - - E1_KOG3883
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10670
Inparanoid 1 1.050 141 1.000 Inparanoid score I4487
Isobase 1 0.950 - 0 Normalized mean entropy S2119
OMA 1 1.010 - - QHG49065
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002909
OrthoInspector 1 1.000 - - otm40569
orthoMCL 1 0.900 - - OOG6_106084
Panther 1 1.100 - - LDO PTHR46152
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2593
SonicParanoid 1 1.000 - - X2273
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.