DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaB-Ras and NKIRAS2

DIOPT Version :9

Sequence 1:NP_001137613.1 Gene:kappaB-Ras / 35667 FlyBaseID:FBgn0040513 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001001349.1 Gene:NKIRAS2 / 28511 HGNCID:17898 Length:191 Species:Homo sapiens


Alignment Length:189 Identity:76/189 - (40%)
Similarity:114/189 - (60%) Gaps:10/189 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IGKVGKVLVCGMKGVGKTALIEQLVYGHVNPETELHPTIEDIYVASVDTGRGGARETLRIYDTAG 70
            :||..||:|||...||||:::|||:||:....:|:..|.|||||.|::|.| |.||.:|.|||.|
Human     1 MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDR-GVREQVRFYDTRG 64

  Fly    71 LQGEQQQLPRHYLQFPDAFVLVYDPMDPRSLDMLADIKADIEKHKEKKEIPVVVLAN---VRARA 132
            |: :..:||||.....|.:||||......|...:..:|.:|:|.|:|||:.:|||.|   ::.:.
Human    65 LR-DGAELPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQR 128

  Fly   133 APNPVEKVMDRANIWCQRERIKHYTVNAMERPSLYEPFTTLCARLHPMQTKSTFPQLRQ 191
            ..:|     |.|..|.:.|::|.:.|:..:|.||.|||..|.:::...|:||.||..|:
Human   129 RVDP-----DVAQHWAKSEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRK 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaB-RasNP_001137613.1 Ras 11..173 CDD:278499 67/164 (41%)
Ras_like_GTPase 13..174 CDD:206648 65/163 (40%)
NKIRAS2NP_001001349.1 Small GTPase-like 1..191 76/189 (40%)
P-loop_NTPase 6..168 CDD:422963 68/168 (40%)
Effector region 35..43 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..191 6/14 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 127 1.000 Domainoid score I5371
eggNOG 1 0.900 - - E1_KOG3883
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4487
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49065
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002909
OrthoInspector 1 1.000 - - otm40569
orthoMCL 1 0.900 - - OOG6_106084
Panther 1 1.100 - - O PTHR46152
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2273
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.