DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaB-Ras and inx-9

DIOPT Version :9

Sequence 1:NP_001137613.1 Gene:kappaB-Ras / 35667 FlyBaseID:FBgn0040513 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_502210.2 Gene:inx-9 / 191694 WormBaseID:WBGene00002131 Length:382 Species:Caenorhabditis elegans


Alignment Length:104 Identity:20/104 - (19%)
Similarity:37/104 - (35%) Gaps:22/104 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 RH---YLQFPDAFVLVYDP--MDPRSLDMLADIKADIEKHKEKKEIPVVVLANVRARAAPNPVEK 139
            ||   |.|:...::.|...  |.|:.:..|:....|         :|::...:..........||
 Worm    96 RHRLTYYQWSSMYLAVAGIAFMIPKFIWRLSQSTTD---------MPLIYFCDTANEIKIETTEK 151

  Fly   140 VMDRANIWCQRERIKHYTVNAMERPSLYEPFTTLCARLH 178
            ...:.....:..|.|..||:.   ||::.     |.|::
 Worm   152 RSSKVKEMARFMRSKITTVHT---PSIFS-----CIRMY 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaB-RasNP_001137613.1 Ras 11..173 CDD:278499 18/97 (19%)
Ras_like_GTPase 13..174 CDD:206648 18/98 (18%)
inx-9NP_502210.2 Innexin 20..359 CDD:279248 20/104 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3883
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.