DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaB-Ras and kbrl-1

DIOPT Version :9

Sequence 1:NP_001137613.1 Gene:kappaB-Ras / 35667 FlyBaseID:FBgn0040513 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_492076.1 Gene:kbrl-1 / 172487 WormBaseID:WBGene00009919 Length:364 Species:Caenorhabditis elegans


Alignment Length:198 Identity:69/198 - (34%)
Similarity:107/198 - (54%) Gaps:9/198 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KIGKVGKVLVCGMKGVGKTALIEQLVYGHVNPETELHPTIEDIYVASVDTGRGGARETLRIYDTA 69
            ::|:..:|:|.|.|.|||||::.|:............|||||.|...::. ...|||.|.::|||
 Worm   165 RMGRAMRVVVVGGKKVGKTAILRQVACVEDVTNKPYEPTIEDTYQVLLEE-PDKAREILILHDTA 228

  Fly    70 GLQGEQQ-QLPRHYLQFPDAFVLVYDPMDPRSLDMLADIKADIEKH--KEKKEIPVVVLANVRAR 131
            |:..... :|.:.|:|..|||||||...|..|.:.:..:|..|::.  |:|||:|:|||||:|.|
 Worm   229 GVSNYGPIELKKAYVQAADAFVLVYSSADYESFNRVDLLKKWIDRQFGKDKKEVPIVVLANMRDR 293

  Fly   132 AAPNPVEKVMDRANIWCQRERIKHYTVNAMERPSLYEPFTTLCARLHPMQTKSTFPQLRQVMQNR 196
              |..|:...  |:.|..||::|.:.|.|.:|.||.: |.......|...||.:...|.:.:::.
 Worm   294 --PATVDSAF--AHSWAAREKVKLFEVTAKDRQSLVD-FIHYVGHRHFHPTKESKFSLSKKLKSE 353

  Fly   197 QKS 199
            :.|
 Worm   354 KSS 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaB-RasNP_001137613.1 Ras 11..173 CDD:278499 63/164 (38%)
Ras_like_GTPase 13..174 CDD:206648 62/163 (38%)
kbrl-1NP_492076.1 small_GTP 179..328 CDD:272973 58/154 (38%)
P-loop_NTPase 183..322 CDD:304359 52/143 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167165
Domainoid 1 1.000 91 1.000 Domainoid score I4923
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10670
Inparanoid 1 1.050 94 1.000 Inparanoid score I3651
Isobase 1 0.950 - 0 Normalized mean entropy S2119
OMA 1 1.010 - - QHG49065
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002909
OrthoInspector 1 1.000 - - oto19361
orthoMCL 1 0.900 - - OOG6_106084
Panther 1 1.100 - - LDO PTHR46152
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2593
SonicParanoid 1 1.000 - - X2273
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.880

Return to query results.
Submit another query.