DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sPLA2 and PLA2-DELTA

DIOPT Version :9

Sequence 1:NP_001014501.1 Gene:sPLA2 / 35665 FlyBaseID:FBgn0033170 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001328472.1 Gene:PLA2-DELTA / 829068 AraportID:AT4G29470 Length:191 Species:Arabidopsis thaliana


Alignment Length:114 Identity:27/114 - (23%)
Similarity:40/114 - (35%) Gaps:46/114 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KWCG------PGNTAANFEDLGRERETDKCCRAHDHCDEIIESHGALHGLPTNTDWFPILKCTCE 107
            |:||      ||....  :||      |.||..||:|.:       |.|: |..|        |.
plant    47 KYCGIGYFGCPGEPPC--DDL------DDCCMTHDNCVD-------LKGM-TYVD--------CH 87

  Fly   108 QQFINCL----QAVNSITAKTLG------------RIYYGSRSRCFANG 140
            :||..|:    |::.....:.:|            .:|.|.....|.:|
plant    88 KQFQRCVNELKQSIQESNNQKVGFSKECPYSTVIPTVYRGMNYGIFFSG 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sPLA2NP_001014501.1 PLA2_bee_venom_like 43..139 CDD:153093 26/111 (23%)
PLA2-DELTANP_001328472.1 PLA2_like 27..139 CDD:414410 27/114 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.