DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sPLA2 and pla2g3

DIOPT Version :9

Sequence 1:NP_001014501.1 Gene:sPLA2 / 35665 FlyBaseID:FBgn0033170 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001032489.1 Gene:pla2g3 / 641423 ZFINID:ZDB-GENE-051113-96 Length:528 Species:Danio rerio


Alignment Length:133 Identity:51/133 - (38%)
Similarity:66/133 - (49%) Gaps:17/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VPGTKWCGPGNTAANFEDLGRERETDKCCRAHDHCDEIIESHGALHGLPTNTDWFPILKCTCEQQ 109
            :|||.|||.||.|..:.|||...|||||||.||||...|.|....||: .||:.|.:..|.|:.:
Zfish   160 IPGTLWCGSGNKATGWTDLGVFEETDKCCREHDHCKHTIPSFSYDHGV-FNTNLFTLSHCDCDNR 223

  Fly   110 FINCLQAVNSITAKTLGRIYYG----SRSRCFANGHPTTGCKQYQEGTFRKRCI-----RYQVDK 165
            |..||..||:..:..:|   ||    .:..||.....|...|:    |:..||:     :|.|.|
Zfish   224 FRRCLLGVNNSMSNLVG---YGFFNVLKMSCFKFSQRTQCAKR----TWWGRCVMSELAQYAVVK 281

  Fly   166 SKA 168
            ..|
Zfish   282 DAA 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sPLA2NP_001014501.1 PLA2_bee_venom_like 43..139 CDD:153093 42/97 (43%)
pla2g3NP_001032489.1 PLA2_bee_venom_like 158..254 CDD:153093 42/97 (43%)
PLA2_like <374..450 CDD:297013
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579351
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.