DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sPLA2 and PLA2G3

DIOPT Version :10

Sequence 1:NP_724556.1 Gene:sPLA2 / 35665 FlyBaseID:FBgn0033170 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_056530.2 Gene:PLA2G3 / 50487 HGNCID:17934 Length:509 Species:Homo sapiens


Alignment Length:122 Identity:38/122 - (31%)
Similarity:57/122 - (46%) Gaps:14/122 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GITVPGTKWCGPGNTAANFEDLGRERETDKCCRAHDHCDEIIESHGALHGLPTNTDWFPILKCTC 106
            |.|:|||.|||.|::|.|..:||..:..|.|||.||.|.:.|......:|: .|..:..|..|.|
Human   150 GWTMPGTLWCGVGDSAGNSSELGVFQGPDLCCREHDRCPQNISPLQYNYGI-RNYRFHTISHCDC 213

  Fly   107 EQQFINCLQAVNSITAKTLGRIYYG----------SRSRCFANGHPTTGCKQYQEGT 153
            :.:|..|||..:...:..:|..::.          .:..|.| .:...||:.|  ||
Human   214 DTRFQQCLQNQHDSISDIVGVAFFNVLEIPCFVLEEQEACVA-WYWWGGCRMY--GT 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sPLA2NP_724556.1 PLA2_bee_venom_like 43..139 CDD:153093 31/105 (30%)
PLA2G3NP_056530.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..149
Phospholipase A2-like. /evidence=ECO:0000269|PubMed:12522102, ECO:0000269|PubMed:15863501, ECO:0000269|PubMed:17868035 150..291 38/122 (31%)
PLA2_bee_venom_like 151..247 CDD:153093 30/96 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..354
PLA2_group_III_like 314..427 CDD:153094
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 458..482
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.