DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sPLA2 and CG42237

DIOPT Version :10

Sequence 1:NP_724556.1 Gene:sPLA2 / 35665 FlyBaseID:FBgn0033170 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_572855.1 Gene:CG42237 / 32261 FlyBaseID:FBgn0250862 Length:363 Species:Drosophila melanogaster


Alignment Length:90 Identity:33/90 - (36%)
Similarity:50/90 - (55%) Gaps:2/90 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TGITVPGTKWCGPGNTAANFEDLGRERETDKCCRAHDHCDEIIESHGALHGLPTNTDWFPILKCT 105
            :|| :|||||||.|:.|..:.|||.|...|:|||.||.|...|.::...:.| .|...:....|.
  Fly   252 SGI-IPGTKWCGTGDIAETYSDLGSEMAMDRCCRQHDLCPIKIRAYQNKYEL-MNDSLYTKSHCI 314

  Fly   106 CEQQFINCLQAVNSITAKTLGRIYY 130
            |:....:||:..|:..::.:|.||:
  Fly   315 CDDMLFSCLKMTNTSASQLMGSIYF 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sPLA2NP_724556.1 PLA2_bee_venom_like 43..139 CDD:153093 32/88 (36%)
CG42237NP_572855.1 PLA2_bee_venom_like 254..348 CDD:153093 32/88 (36%)

Return to query results.
Submit another query.