DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sPLA2 and GIIIspla2

DIOPT Version :9

Sequence 1:NP_001014501.1 Gene:sPLA2 / 35665 FlyBaseID:FBgn0033170 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001285008.1 Gene:GIIIspla2 / 31747 FlyBaseID:FBgn0030013 Length:217 Species:Drosophila melanogaster


Alignment Length:128 Identity:37/128 - (28%)
Similarity:61/128 - (47%) Gaps:13/128 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ITVPGTKWCGPGNTA-ANFEDLGRERETDKCCRAHDHCDEIIESHGALHGLPTNTDWF-----PI 101
            :..|.|:|||.||.| ..:.|||...:.|||||.||||...|:      |:....|.|     .:
  Fly    84 LIAPNTRWCGRGNLANGTYNDLGGASKADKCCRKHDHCKMWID------GMSNRYDLFNYRPYTL 142

  Fly   102 LKCTCEQQFINCLQAVNSITAKTLGRIYYG-SRSRCFANGHPTTGCKQYQEGTFRKRCIRYQV 163
            ..|:|:.:|..||:......|..:|::::. .:::||.....|...::...|.....|::.:|
  Fly   143 SHCSCDLRFRTCLKMAGDEDANAIGKLFFNVVQTQCFGLKAETVCVQRGGSGKETDPCLKEEV 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sPLA2NP_001014501.1 PLA2_bee_venom_like 43..139 CDD:153093 33/102 (32%)
GIIIspla2NP_001285008.1 PLA2_bee_venom_like 84..181 CDD:153093 33/102 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469611
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8069
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.