DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sPLA2 and CG3009

DIOPT Version :9

Sequence 1:NP_001014501.1 Gene:sPLA2 / 35665 FlyBaseID:FBgn0033170 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001162665.1 Gene:CG3009 / 31402 FlyBaseID:FBgn0029720 Length:342 Species:Drosophila melanogaster


Alignment Length:169 Identity:53/169 - (31%)
Similarity:76/169 - (44%) Gaps:34/169 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GITVPGTKWCGPGNTAANFEDLGRERETDKCCRAHDHCDEIIESHGALHGLPTNTDWFPILKCTC 106
            |...|||||||||..|.:::|||.....|:|||.||.|.:::.......|| .|...|....|.|
  Fly   101 GFIYPGTKWCGPGTAATSYDDLGAHAREDRCCREHDMCPDVLNVGECRRGL-CNRGTFTRSHCDC 164

  Fly   107 EQQFINCLQAVNSITAKTLGRIYYG-SRSRCFANGHPTTGCKQYQEGTFRKRCIRYQVDKSKAKV 170
            :.:|..||||.|:.||.|||.|:|. .:..||....|.:..:::::       ..|:.|...|:.
  Fly   165 DARFRRCLQAANTETANTLGAIFYNVVQVTCFQERSPCSAHQRFED-------FYYRTDHCPAEF 222

  Fly   171 WQFYDM------------------------PFFTIPASA 185
            .| .|:                        |.:||||.:
  Fly   223 RQ-ADLYVPPHGDNLIAKILAHPQGRALAAPSWTIPAKS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sPLA2NP_001014501.1 PLA2_bee_venom_like 43..139 CDD:153093 41/96 (43%)
CG3009NP_001162665.1 PLA2_bee_venom_like 102..198 CDD:153093 41/96 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8069
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.