DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sPLA2 and Pla2g3

DIOPT Version :9

Sequence 1:NP_001014501.1 Gene:sPLA2 / 35665 FlyBaseID:FBgn0033170 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001099485.1 Gene:Pla2g3 / 289733 RGDID:1305323 Length:506 Species:Rattus norvegicus


Alignment Length:138 Identity:41/138 - (29%)
Similarity:60/138 - (43%) Gaps:16/138 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EDEDIYNQALPPVPH----TGITVPGTKWCGPGNTAANFEDLGRERETDKCCRAHDHCDEIIESH 86
            |..:..::..|...|    .|.|:|||.|||.||:|.|..:||.....|.|||.||.|.:.|...
  Rat   130 EKRETEHRGAPAGEHQRRRRGWTIPGTLWCGVGNSAENASELGMFHGPDFCCREHDQCPQTISPL 194

  Fly    87 GALHGLPTNTDWFPILKCTCEQQFINCLQAVNSITAKTLGRIYYG----------SRSRCFANGH 141
            ...:|: .|..:..|..|.|:.:|..||::.....|..:|..::.          .:..|.| .|
  Rat   195 QYNYGI-RNFRFHTISHCDCDARFQQCLRSQGDSIADIMGVAFFNVLEIPCFVLKEQETCVA-WH 257

  Fly   142 PTTGCKQY 149
            ...||:.|
  Rat   258 WWGGCRTY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sPLA2NP_001014501.1 PLA2_bee_venom_like 43..139 CDD:153093 32/105 (30%)
Pla2g3NP_001099485.1 PLA2_bee_venom_like 151..247 CDD:153093 31/96 (32%)
PLA2_group_III_like 299..424 CDD:153094
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339587
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12253
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.900

Return to query results.
Submit another query.