DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sPLA2 and CG30503

DIOPT Version :9

Sequence 1:NP_001014501.1 Gene:sPLA2 / 35665 FlyBaseID:FBgn0033170 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001137612.1 Gene:CG30503 / 246656 FlyBaseID:FBgn0050503 Length:173 Species:Drosophila melanogaster


Alignment Length:178 Identity:77/178 - (43%)
Similarity:100/178 - (56%) Gaps:17/178 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLREAFFFGLLAMAWAFGDEAIFEDEDIYNQALPPVPHTGITVPGTKWCGPGNTAANFEDLGRER 67
            |.|.||...||.:.:|....|                ...|||||||||||||.|||::|||.||
  Fly     2 LSRAAFLTVLLTLIYASHAAA----------------GLSITVPGTKWCGPGNIAANYDDLGTER 50

  Fly    68 ETDKCCRAHDHCDEIIESHGALHGLPTNTDWFPILKCTCEQQFINCLQAVNSITAKTLGRIYYGS 132
            |.|.||||||:|:|.|.......|| .|..:|||..|.||..|.|||.|:.:..:..||:||:.:
  Fly    51 EVDTCCRAHDNCEEKIPPLEEAFGL-RNDGFFPIFSCACESAFRNCLTALRNGHSLALGKIYFNT 114

  Fly   133 RSRCFANGHPTTGCKQYQEGTFRKRCIRYQVDKSKAKVWQFYDMPFFT 180
            :..||..|||...|::.|...|..||:.|:||:.:.:.|||||:..:|
  Fly   115 KEVCFGYGHPIVSCQEKQADLFETRCLSYRVDEGQPQRWQFYDLALYT 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sPLA2NP_001014501.1 PLA2_bee_venom_like 43..139 CDD:153093 52/95 (55%)
CG30503NP_001137612.1 Phospholip_A2_2 28..121 CDD:368629 50/93 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469612
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CY34
Homologene 1 1.000 - - H45252
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8069
OMA 1 1.010 - - QHG28240
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014366
OrthoInspector 1 1.000 - - mtm9659
orthoMCL 1 0.900 - - OOG6_109206
Panther 1 1.100 - - P PTHR12253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.700

Return to query results.
Submit another query.