DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sPLA2 and Pla2g3

DIOPT Version :9

Sequence 1:NP_001014501.1 Gene:sPLA2 / 35665 FlyBaseID:FBgn0033170 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_766379.2 Gene:Pla2g3 / 237625 MGIID:2444945 Length:504 Species:Mus musculus


Alignment Length:138 Identity:40/138 - (28%)
Similarity:58/138 - (42%) Gaps:16/138 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EDEDIYNQALPPVPH----TGITVPGTKWCGPGNTAANFEDLGRERETDKCCRAHDHCDEIIESH 86
            |...|.....|...|    .|.|:|||.|||.||:|.|..:||.....|.|||.||.|.:.|...
Mouse   126 EKRAIEQSGAPDREHRRRRRGWTIPGTLWCGVGNSAENASELGVFHGPDLCCREHDQCPQTISPL 190

  Fly    87 GALHGLPTNTDWFPILKCTCEQQFINCLQAVNSITAKTLGRIYYG----------SRSRCFANGH 141
            ...:|: .|..:..|..|.|:.:|..||::.....:..:|..::.          .:..|.| .:
Mouse   191 QYNYGI-RNFRFHTISHCDCDARFQQCLRSQGDSISDIMGVAFFNVLEIPCFVLKEQEACVA-WN 253

  Fly   142 PTTGCKQY 149
            ...||:.|
Mouse   254 WWGGCRAY 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sPLA2NP_001014501.1 PLA2_bee_venom_like 43..139 CDD:153093 31/105 (30%)
Pla2g3NP_766379.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..143 4/16 (25%)
Phospholipase A2-like. /evidence=ECO:0000250|UniProtKB:Q9NZ20 146..287 36/118 (31%)
PLA2_bee_venom_like 147..243 CDD:153093 30/96 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..350
PLA2_group_III_like 295..422 CDD:153094
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835949
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8069
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.850

Return to query results.
Submit another query.