DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sPLA2 and C03H5.4

DIOPT Version :9

Sequence 1:NP_001014501.1 Gene:sPLA2 / 35665 FlyBaseID:FBgn0033170 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_493719.3 Gene:C03H5.4 / 182181 WormBaseID:WBGene00015406 Length:160 Species:Caenorhabditis elegans


Alignment Length:130 Identity:30/130 - (23%)
Similarity:46/130 - (35%) Gaps:39/130 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 WCGPGNTAANFEDLGRERETDKCCRAHDHCDEIIESHGALHGLPTNTDWFPILKCTCEQQFINCL 114
            :||.|.:....:|:      |:||..||.|.|.::........|  .::|||....|:.|.|:| 
 Worm    44 YCGIGGSGDILDDI------DECCANHDKCYEDLDLKKTCWTTP--FEYFPIYSWKCQNQTIHC- 99

  Fly   115 QAVNSITAKTLGRIYYGSRSRCFANGHPTTG--CKQYQEGTFRKRCIRYQVDKSKAKVWQFYDMP 177
                    .||..          |:.||...  |.       .:.|   :.|:...:.|..|..|
 Worm   100 --------DTLSE----------ASDHPVLAHECS-------NQLC---ECDRKLVECWAKYPEP 136

  Fly   178  177
             Worm   137  136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sPLA2NP_001014501.1 PLA2_bee_venom_like 43..139 CDD:153093 21/88 (24%)
C03H5.4NP_493719.3 PLA2c 20..134 CDD:153091 28/126 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.