DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sPLA2 and LOC101885160

DIOPT Version :9

Sequence 1:NP_001014501.1 Gene:sPLA2 / 35665 FlyBaseID:FBgn0033170 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_005169114.1 Gene:LOC101885160 / 101885160 -ID:- Length:463 Species:Danio rerio


Alignment Length:118 Identity:39/118 - (33%)
Similarity:57/118 - (48%) Gaps:15/118 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VPGTKWCGPGNTAANFEDLGRERETDKCCRAHDHCDEIIESHGALHGLPTNTDWFPILKCTCEQQ 109
            :|||.|||.|..|.::|.||.....|:|||.||||:.||.|.....|: .|..:|.:..|.|:.:
Zfish   155 LPGTLWCGRGTNANDYEQLGMFEHADRCCREHDHCEHIIRSFSVNFGV-FNPTFFTVSHCDCDHR 218

  Fly   110 FINCLQAVNSITAKTLGRIYYG-SRSRCFANGHPTTGCKQYQEGTFRKRCIRY 161
            |..||...|...:..:|..::. .:.|||             |...|::|.:|
Zfish   219 FKQCLLGGNDTISNMVGYSFFNVLKIRCF-------------EFIQRRQCTQY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sPLA2NP_001014501.1 PLA2_bee_venom_like 43..139 CDD:153093 35/94 (37%)
LOC101885160XP_005169114.1 Phospholip_A2_2 155..249 CDD:283483 35/107 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579352
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.