DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11123 and puf-6

DIOPT Version :9

Sequence 1:NP_610276.1 Gene:CG11123 / 35664 FlyBaseID:FBgn0033169 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_496773.1 Gene:puf-6 / 174947 WormBaseID:WBGene00004242 Length:485 Species:Caenorhabditis elegans


Alignment Length:257 Identity:48/257 - (18%)
Similarity:93/257 - (36%) Gaps:90/257 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 NNVFEQTHDQEIH------LASNQIVSKALESLVGFVDDVQLERFFSKF---GDNLRPMCSDRFA 123
            :|||:..  ||:.      :.::||....::.:|..: .|.:..||..|   ||:|..:|.|::.
 Worm   193 SNVFQLI--QELSTFDLAAMCTDQISIHVIQRVVKQL-PVDMWTFFVHFLSSGDSLMAVCQDKYG 254

  Fly   124 SHVLQKMLE--------------IAFLRGVGKSAAQDTSDAASANKKAKPDAAQEEEEYNLQ--- 171
            ..::|::::              |..|..:.....::....:|          .|...|.:|   
 Worm   255 CRLVQQVIDRLAENPKLPCFKFRIQLLHSLMTCIVRNCYRLSS----------NEFANYVIQYVI 309

  Fly   172 --ADFTDDHREKCRQFVLRISKFMLNNLEDFVWDACASHIMRTAILCLVGMHVPKIAFEKGGTEI 234
              :...:.:|:..      |.|.:|.||.....|..|||::..|.|                   
 Worm   310 KSSGIMEMYRDTI------IDKCLLRNLLSMSQDKYASHVIEGAFL------------------- 349

  Fly   235 AKHRKMYSVPDEWQEVMKE----FPQRLE---------MWPQFGDFPYQDHSSSLLGVICLA 283
                  ::.|....|:|:|    :.:.:|         ::.|:|::..|...|     ||.|
 Worm   350 ------FAPPALLHEMMEEIFSGYVKDVELNRDALDILLFHQYGNYVVQQMIS-----ICTA 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11123NP_610276.1 Pumilio 112..>134 CDD:214475 5/35 (14%)
puf-6NP_496773.1 Pumilio 82..449 CDD:277559 48/257 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D238378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.