DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment so and PHO2

DIOPT Version :9

Sequence 1:NP_476733.1 Gene:so / 35662 FlyBaseID:FBgn0003460 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_010177.1 Gene:PHO2 / 851452 SGDID:S000002264 Length:559 Species:Saccharomyces cerevisiae


Alignment Length:121 Identity:33/121 - (27%)
Similarity:50/121 - (41%) Gaps:31/121 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 KEKSRSVLRDWYSHNPYPSPREKRDLAEATGLTTTQVSNWFKNRRQRDRAAEH---KD------- 280
            |.::..||:..:..||.||..|::.:::..|:....|..||:|||.:.|..:|   ||       
Yeast    85 KGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKKQHGSNKDTIPSSQS 149

  Fly   281 ---------GSTDKQHLDSSSDSEMEGSMLPSQSAQHQQQQQQQQHSPGNSSGNNN 327
                     ||||...:.::|.|          |..|.:........|.||  |||
Yeast   150 RDIANDYDRGSTDNNLVTTTSTS----------SIFHDEDLTFFDRIPLNS--NNN 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soNP_476733.1 SIX1_SD 103..212 CDD:293483
homeodomain 223..274 CDD:238039 15/47 (32%)
PHO2NP_010177.1 COG5576 53..183 CDD:227863 27/107 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.