DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment so and STM

DIOPT Version :9

Sequence 1:NP_476733.1 Gene:so / 35662 FlyBaseID:FBgn0003460 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_176426.1 Gene:STM / 842534 AraportID:AT1G62360 Length:382 Species:Arabidopsis thaliana


Alignment Length:304 Identity:77/304 - (25%)
Similarity:117/304 - (38%) Gaps:75/304 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PTGLSGSVALHNNNNNNSSTSNNNNSTLDIMAHNGGGAGGGLHLNSSSNGGGGGGVVSGGGSGGR 95
            |.|....||    ::::.|:.....|.::| .||...|||....:|||:.......:.......|
plant    74 PQGTKNKVA----SSSSPSSCAPAYSLMEI-HHNEIVAGGINPCSSSSSSASVKAKIMAHPHYHR 133

  Fly    96 -----ENLPSFGFTQEQVACVCEVLQQA-------------GNIERLGRFLWSLPQCDKLQLNES 142
                 .|....|...|.||.:.|....|             |....|.:|:.:  .|:.|...|.
plant   134 LLAAYVNCQKVGAPPEVVARLEEACSSAAAAAASMGPTGCLGEDPGLDQFMEA--YCEMLVKYEQ 196

  Fly   143 VLK---AKAVVAFHR--GQYKELYRLLEHHHFSA---------QNHAKLQALWLKAHYV----EA 189
            .|.   .:|:|...|  .|:|.| .|.....||.         .|.:..:.:.:...:|    |.
plant   197 ELSKPFKEAMVFLQRVECQFKSL-SLSSPSSFSGYGETAIDRNNNGSSEEEVDMNNEFVDPQAED 260

  Fly   190 EKLRGRPLGAVGKY---------RVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYSHN---PY 242
            .:|:|:.|.....|         :.|:|..||:              ::|..|.||:|.:   ||
plant   261 RELKGQLLRKYSGYLGSLKQEFMKKRKKGKLPK--------------EARQQLLDWWSRHYKWPY 311

  Fly   243 PSPREKRDLAEATGLTTTQVSNWFKNRRQRDRAAEHKDGSTDKQ 286
            ||.::|..|||:|||...|::|||.|:|:|     |...|.|.|
plant   312 PSEQQKLALAESTGLDQKQINNWFINQRKR-----HWKPSEDMQ 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soNP_476733.1 SIX1_SD 103..212 CDD:293483 30/148 (20%)
homeodomain 223..274 CDD:238039 23/53 (43%)
STMNP_176426.1 KNOX1 121..156 CDD:397730 6/34 (18%)
KNOX2 173..216 CDD:397731 10/44 (23%)
ELK 262..283 CDD:397729 4/20 (20%)
Homeobox_KN 302..341 CDD:399131 19/38 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I2393
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.