DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment so and six2a

DIOPT Version :9

Sequence 1:NP_476733.1 Gene:so / 35662 FlyBaseID:FBgn0003460 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_571858.1 Gene:six2a / 83415 ZFINID:ZDB-GENE-010412-1 Length:288 Species:Danio rerio


Alignment Length:293 Identity:180/293 - (61%)
Similarity:206/293 - (70%) Gaps:37/293 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LPSFGFTQEQVACVCEVLQQAGNIERLGRFLWSLPQCDKLQLNESVLKAKAVVAFHRGQYKELYR 162
            ||:|||||||||||||||||.||||||||||||||.|:.|..||||||||||||||||.::|||:
Zfish     4 LPTFGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYK 68

  Fly   163 LLEHHHFSAQNHAKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKE 227
            :||.|.||..||.|||.|||||||:||||||||||||||||||||||||||:|||||||||||||
Zfish    69 ILESHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKE 133

  Fly   228 KSRSVLRDWYSHNPYPSPREKRDLAEATGLTTTQVSNWFKNRRQRDRAAEHKDGSTDKQHLDSSS 292
            |||||||:||:|||||||||||:|||||||||||||||||||||||||||.|:...::....:|.
Zfish   134 KSRSVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERENNENSNTNSH 198

  Fly   293 D---SEMEGS----------MLPSQSAQHQQQQQQQQHSPGNSSGNNNGLHQQQLQHVAAEQGLQ 344
            :   |.|.|:          ..||.:..|...      ||.....:|:||  |.|..:|...|..
Zfish   199 NPLTSSMNGNKTILGSSDDDKTPSGTPDHTSS------SPALLLTSNSGL--QSLHGLAPPPGPS 255

  Fly   345 ----------HHPHQPHP------ASNIANVAA 361
                      ||.|..|.      :||:.::.:
Zfish   256 AIPVPSVDSVHHHHSLHDTILNPMSSNLVDLGS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soNP_476733.1 SIX1_SD 103..212 CDD:293483 90/108 (83%)
homeodomain 223..274 CDD:238039 47/50 (94%)
six2aNP_571858.1 SIX1_SD 9..118 CDD:293483 90/108 (83%)
homeodomain 129..180 CDD:238039 47/50 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 199 1.000 Domainoid score I3007
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 354 1.000 Inparanoid score I2212
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001063
OrthoInspector 1 1.000 - - otm25804
orthoMCL 1 0.900 - - OOG6_106461
Panther 1 1.100 - - LDO PTHR10390
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4764
SonicParanoid 1 1.000 - - X333
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.850

Return to query results.
Submit another query.