DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment so and KNAT1

DIOPT Version :9

Sequence 1:NP_476733.1 Gene:so / 35662 FlyBaseID:FBgn0003460 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_192555.1 Gene:KNAT1 / 826364 AraportID:AT4G08150 Length:398 Species:Arabidopsis thaliana


Alignment Length:413 Identity:81/413 - (19%)
Similarity:124/413 - (30%) Gaps:173/413 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TPPYSPTGLSGSVALHNNNNNNSSTSNNNNSTLDIMAHNGGGAGGGLHLNSSSNGGGGGGVVSGG 90
            |.|...:.|...::..|.|:|.|.|:||||:                  |:|||.|.|....:..
plant    10 TTPQRVSFLYSPISSSNKNDNTSDTNNNNNN------------------NNSSNYGPGYNNTNNN 56

  Fly    91 GSGGRENL-PSFGFTQEQVACVC--------------EVLQQAGNIERLGRFLWSLPQCDKLQ-- 138
            ....:..| |.......|....|              .|..:|.: .|:..:...:......|  
plant    57 NHHHQHMLFPHMSSLLPQTTENCFRSDHDQPNNNNNPSVKSEASS-SRINHYSMLMRAIHNTQEA 120

  Fly   139 ---LNESVLKAKAVVAFHRGQYKELYRLLEHHHFSAQNHAKLQALWLKA------------HYVE 188
               .|::|...:|:.|          :::.|.|:|....|.|....:.|            ...|
plant   121 NNNNNDNVSDVEAMKA----------KIIAHPHYSTLLQAYLDCQKIGAPPDVVDRITAARQDFE 175

  Fly   189 AEKLRGRPLGAVG------------------KYR-------------VRR---------KFPL-- 211
            |.:.|..|..:..                  |||             :||         :.|:  
plant   176 ARQQRSTPSVSASSRDPELDQFMEAYCDMLVKYREELTRPIQEAMEFIRRIESQLSMLCQSPIHI 240

  Fly   212 --------------------------------PRTIWDGEETSYCFK------------------ 226
                                            ||. .|.|..::..|                  
plant   241 LNNPDGKSDNMGSSDEEQENNSGGETELPEIDPRA-EDRELKNHLLKKYSGYLSSLKQELSKKKK 304

  Fly   227 -----EKSRSVLRDWYSHN---PYPSPREKRDLAEATGLTTTQVSNWFKNRRQRDRAAEHKDGST 283
                 :::|..|..|:..:   ||||..||..|||:|||...|::|||.|:|:|     |...|.
plant   305 KGKLPKEARQKLLTWWELHYKWPYPSESEKVALAESTGLDQKQINNWFINQRKR-----HWKPSE 364

  Fly   284 DKQHLDSSSDSEMEGSMLPSQSA 306
            |.|.:      .|:|...|..:|
plant   365 DMQFM------VMDGLQHPHHAA 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soNP_476733.1 SIX1_SD 103..212 CDD:293483 26/213 (12%)
homeodomain 223..274 CDD:238039 23/76 (30%)
KNAT1NP_192555.1 KNOX1 133..172 CDD:281744 8/48 (17%)
KNOX2 189..234 CDD:281745 5/44 (11%)
ELK 279..300 CDD:281743 2/20 (10%)
Homeobox_KN 319..358 CDD:283551 19/38 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I2393
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.