DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment so and six4b

DIOPT Version :9

Sequence 1:NP_476733.1 Gene:so / 35662 FlyBaseID:FBgn0003460 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_571792.2 Gene:six4b / 65232 ZFINID:ZDB-GENE-010201-1 Length:615 Species:Danio rerio


Alignment Length:312 Identity:149/312 - (47%)
Similarity:189/312 - (60%) Gaps:52/312 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 SFGFTQEQVACVCEVLQQAGNIERLGRFLWSLPQCDKLQLNESVLKAKAVVAFHRGQYKELYRLL 164
            |..|:.||||||||.|.|.||::||.||||||||.|.|:.|||:|||:|:||||..:|:|||.:|
Zfish    62 SLAFSPEQVACVCEALMQGGNVDRLARFLWSLPQSDLLRGNESILKAQAIVAFHHARYQELYCIL 126

  Fly   165 EHHHFSAQNHAKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKS 229
            |:|.||..||:.||.:|.||.|.||||.||||||||.|||:|||:||||||||||||.|||||:|
Zfish   127 ENHSFSPSNHSSLQDMWYKARYTEAEKARGRPLGAVDKYRLRRKYPLPRTIWDGEETVYCFKERS 191

  Fly   230 RSVLRDWYSHNPYPSPREKRDLAEATGLTTTQVSNWFKNRRQRDRAAEHKDGSTDKQHLDSSSDS 294
            |:.|:|.|..|.||||.|||:||:.|||:.|||||||||||||||...           ::.|.|
Zfish   192 RNALKDMYKRNRYPSPAEKRNLAKMTGLSLTQVSNWFKNRRQRDRNPS-----------EAQSKS 245

  Fly   295 EMEGSMLPSQSAQHQQQQQQQQHSPGN-SSGNNNGLHQQQLQHVAAEQGLQHHPHQPHPAS---- 354
            |.:|    :.|.:.:..:.|:..||.. |||:::.:                 ||...|.:    
Zfish   246 ESDG----NHSTEDESSKGQEDLSPRPLSSGSSSSV-----------------PHGTAPPTVYSD 289

  Fly   355 -------NIANVAATKSSGGG--GGGGVSAAAAAQMQMPPLTAAVAYSHLHS 397
                   .|.:|.....||||  ..|.:::..|..:.      :.||.|.||
Zfish   290 GGTTVIQQIGDVKMPSHSGGGMSYNGDLASVNAHYIN------SGAYGHSHS 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soNP_476733.1 SIX1_SD 103..212 CDD:293483 72/108 (67%)
homeodomain 223..274 CDD:238039 36/50 (72%)
six4bNP_571792.2 SIX1_SD 65..174 CDD:293483 72/108 (67%)
homeodomain 185..239 CDD:238039 38/53 (72%)
E_Pc_C <395..>478 CDD:284226
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.