DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment so and ANHX

DIOPT Version :9

Sequence 1:NP_476733.1 Gene:so / 35662 FlyBaseID:FBgn0003460 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_006719806.1 Gene:ANHX / 647589 HGNCID:40024 Length:492 Species:Homo sapiens


Alignment Length:319 Identity:79/319 - (24%)
Similarity:114/319 - (35%) Gaps:70/319 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 NESVLKAKAVVAFHRGQYKELYRLLEHHHFSAQNHAKLQALWLKAHYVEAEKLRGRPLGA----- 199
            |..|..|.|.|...:.|.:...||||.......:...:| ||...||    :|..|.||.     
Human    58 NADVALACARVLDQQEQQQAACRLLEGCQVPGGSQELVQ-LWNDIHY----RLVMRRLGVAALTP 117

  Fly   200 VGKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDW-YSHNPYPSPREKRDLAEATGLTTTQVS 263
            |.|:|.|::.|.|.::......|..|..:.|..|.:: ...|..||..|:.:||..|.||..||.
Human   118 VQKFRCRKRNPPPPSLCPEGLKSRNFPREVREKLHNFAVGVNTNPSKAERENLALETSLTPEQVY 182

  Fly   264 NWFKNRRQRDRAAEHKDGSTDKQHLDSSSDSEMEGSMLPSQSAQHQQQQQQQQ-----HSPGNSS 323
            |||.|.|:|.||.        .||            |.|:|.|..:....:::     ...||..
Human   183 NWFANYRRRQRAL--------PQH------------MKPAQQATAEDPGARERGPDLLQPSGNPR 227

  Fly   324 GNNNGLHQQQLQHVAAEQGLQHHPH------QP------HPA-SNIANVAATKSSGGG------- 368
            .::..:.:.|......|:|....|.      :|      .|| ..::.....:|..||       
Human   228 VDSGFVDRPQWSEEREEKGPPQSPQTTQGPWEPLALAPDFPADETVSKPLDVRSLPGGEMYQEGP 292

  Fly   369 ------------GGGGVSAAAAAQMQMPPLTAAVAYSHLHSVMGAMPMTAMYDMGEYQH 415
                        |.|....||...|..|.|.|..::  |.|:..|......:..|:..|
Human   293 GHDPATLPLFCPGPGLCPLAAGNDMLNPSLAAPESW--LMSLALASSKEVSFQTGQLVH 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soNP_476733.1 SIX1_SD 103..212 CDD:293483 24/76 (32%)
homeodomain 223..274 CDD:238039 20/51 (39%)
ANHXXP_006719806.1 SIX1_SD <79..130 CDD:293483 18/55 (33%)
homeodomain 139..193 CDD:238039 21/53 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.