DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment so and SIX6

DIOPT Version :9

Sequence 1:NP_476733.1 Gene:so / 35662 FlyBaseID:FBgn0003460 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_031400.2 Gene:SIX6 / 4990 HGNCID:10892 Length:246 Species:Homo sapiens


Alignment Length:276 Identity:137/276 - (49%)
Similarity:182/276 - (65%) Gaps:54/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LPSFGFTQEQVACVCEVLQQAGNIERLGRFLWSLP----QCDKLQLNESVLKAKAVVAFHRGQYK 158
            ||...|:.:|||.|||.|:::|::|||||||||||    .|:.|..|||||:|:|:||||.|.|:
Human     4 LPILNFSPQQVAGVCETLEESGDVERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHGGNYR 68

  Fly   159 ELYRLLEHHHFSAQNHAKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSY 223
            |||.:||:|.|:.::|||||||||:|||.|||||||||||.|.|||||:||||||||||||:.::
Human    69 ELYHILENHKFTKESHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTH 133

  Fly   224 CFKEKSRSVLRDWYSHNPYPSPREKRDLAEATGLTTTQVSNWFKNRRQRDRAAEHKDGSTDKQHL 288
            ||||::|.:||:||..:|||:|.:||:||:|||||.|||.|||||||||||||            
Human   134 CFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAA------------ 186

  Fly   289 DSSSDSEMEGSMLPSQSAQHQQQQQQQQHSPGNSSGNNNGLHQQ-----QLQHVAAEQGLQHHPH 348
                            :|:::.|||..      |.|:...|..:     ::..||..        
Human   187 ----------------AAKNRLQQQVL------SQGSGRALRAEGDGTPEVLGVATS-------- 221

  Fly   349 QPHPASNIANVAATKS 364
               ||:::::.|||.:
Human   222 ---PAASLSSKAATSA 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soNP_476733.1 SIX1_SD 103..212 CDD:293483 74/112 (66%)
homeodomain 223..274 CDD:238039 34/50 (68%)
SIX6NP_031400.2 SIX1_SD 9..122 CDD:318970 74/112 (66%)
homeodomain 130..178 CDD:238039 28/47 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..246 13/62 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X333
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.