DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment so and six1a

DIOPT Version :9

Sequence 1:NP_476733.1 Gene:so / 35662 FlyBaseID:FBgn0003460 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001009904.1 Gene:six1a / 494168 ZFINID:ZDB-GENE-040718-155 Length:283 Species:Danio rerio


Alignment Length:267 Identity:182/267 - (68%)
Similarity:198/267 - (74%) Gaps:20/267 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LPSFGFTQEQVACVCEVLQQAGNIERLGRFLWSLPQCDKLQLNESVLKAKAVVAFHRGQYKELYR 162
            ||||||||||||||||||||.||:|||||||||||.||.|..||||||||||||||||.::|||:
Zfish     4 LPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYK 68

  Fly   163 LLEHHHFSAQNHAKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKE 227
            :||.:.||..||.|:|.||||||||||||||||||||||||||||||||||||||||||||||||
Zfish    69 ILESYQFSTHNHPKMQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKE 133

  Fly   228 KSRSVLRDWYSHNPYPSPREKRDLAEATGLTTTQVSNWFKNRRQRDRAAEHKD-------GSTDK 285
            |||||||:||:|||||||||||:|||||||||||||||||||||||||||.|:       |...|
Zfish   134 KSRSVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERENGENNGVGGK 198

  Fly   286 QHLDSSSD------SEMEGSMLPSQSAQHQQ--QQQQQQHSPGNSSGNNNGLHQQQLQHVAAEQG 342
            |...|..|      |..|....|.||.:|..  ..|...::||..:....||......|     |
Zfish   199 QSQRSPLDGVKSLMSSSEDEFSPPQSPEHSSVLLLQGTMNNPGAPAYPMPGLGAPHPLH-----G 258

  Fly   343 LQHHPHQ 349
            :|.||||
Zfish   259 MQGHPHQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soNP_476733.1 SIX1_SD 103..212 CDD:293483 89/108 (82%)
homeodomain 223..274 CDD:238039 47/50 (94%)
six1aNP_001009904.1 SIX1_SD 9..118 CDD:293483 89/108 (82%)
homeodomain 129..180 CDD:238039 47/50 (94%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 168..264 37/100 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587900
Domainoid 1 1.000 199 1.000 Domainoid score I3007
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 354 1.000 Inparanoid score I2212
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001063
OrthoInspector 1 1.000 - - otm25804
orthoMCL 1 0.900 - - OOG6_106461
Panther 1 1.100 - - O PTHR10390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X333
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.750

Return to query results.
Submit another query.