DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment so and Optix

DIOPT Version :9

Sequence 1:NP_476733.1 Gene:so / 35662 FlyBaseID:FBgn0003460 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001260793.1 Gene:Optix / 44108 FlyBaseID:FBgn0025360 Length:492 Species:Drosophila melanogaster


Alignment Length:364 Identity:147/364 - (40%)
Similarity:199/364 - (54%) Gaps:79/364 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LPSFGFTQEQVACVCEVLQQAGNIERLGRFLWSLP----------QCDKLQLNESVLKAKAVVAF 152
            :|:..|:..||..||:.|:.:|:||||.|||||||          .|      |:||:|:||||:
  Fly    32 VPTLAFSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNMHEILNC------EAVLRARAVVAY 90

  Fly   153 HRGQYKELYRLLEHHHFSAQNHAKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWD 217
            |.|.::|||.::|:|.|:..::.||||:||:|||:||||||||.||.|.|||||:|||||.||||
  Fly    91 HVGNFRELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDKYRVRKKFPLPPTIWD 155

  Fly   218 GEETSYCFKEKSRSVLRDWYSHNPYPSPREKRDLAEATGLTTTQVSNWFKNRRQRDRAAEHK--- 279
            ||:.::||||::||:||:||..:|||:|.:||:||:||||..|||.|||||||||||||..|   
  Fly   156 GEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNRRQRDRAAAAKNRI 220

  Fly   280 ----------------DGSTDKQHLDSSSDSEMEGSMLPSQSAQHQQQQQQQQHSPGNSSGNNNG 328
                            ||:......|||......|:..|..|:      .|.|||||::|   ||
  Fly   221 QHSQNSSGMGCRSRRADGAASPTPSDSSDSDISLGTHSPVPSS------LQLQHSPGSTS---NG 276

  Fly   329 LHQQQLQHVAAEQGLQHHPHQPHPASN-----------IANVAATKSS-----GGGGGGGVSAAA 377
            .:.:       |:.|.....:|...|.           :|:...|...     |||.|.|.....
  Fly   277 ANDR-------EESLSVDDDKPRDLSGSLPLPLSLPLPLASPTHTPPQLPPGYGGGAGAGPGGPL 334

  Fly   378 AAQMQMPP--LTAAV----------AYSHLHSVMGAMPM 404
            .....:||  |.||.          ::|:|..:....|:
  Fly   335 TGPGCLPPFKLDAATSLFSAGCYLQSFSNLKEMSQQFPI 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soNP_476733.1 SIX1_SD 103..212 CDD:293483 63/118 (53%)
homeodomain 223..274 CDD:238039 34/50 (68%)
OptixNP_001260793.1 SIX1_SD 37..150 CDD:293483 63/118 (53%)
homeodomain 158..206 CDD:238039 28/47 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467666
Domainoid 1 1.000 48 1.000 Domainoid score I4491
eggNOG 1 0.900 - - E1_KOG0775
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I2393
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1040044at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X333
87.900

Return to query results.
Submit another query.