DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment so and six3a

DIOPT Version :9

Sequence 1:NP_476733.1 Gene:so / 35662 FlyBaseID:FBgn0003460 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_571437.1 Gene:six3a / 30635 ZFINID:ZDB-GENE-990415-127 Length:294 Species:Danio rerio


Alignment Length:220 Identity:127/220 - (57%)
Similarity:165/220 - (75%) Gaps:11/220 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LPSFGFTQEQVACVCEVLQQAGNIERLGRFLWSLP----QCDKLQLNESVLKAKAVVAFHRGQYK 158
            ||:..|:.||||.|||.|::.|:||||||||||||    .|:.:..:||:|:|:||||||.|.::
Zfish    44 LPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFR 108

  Fly   159 ELYRLLEHHHFSAQNHAKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSY 223
            :||.:||:|.|:..:|.||||:||:|||.|||||||||||.|.|||||:||||||||||||:.::
Zfish   109 DLYHILENHKFTKDSHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTH 173

  Fly   224 CFKEKSRSVLRDWYSHNPYPSPREKRDLAEATGLTTTQVSNWFKNRRQRDRAAEHKD-------G 281
            ||||::||:||:||..:|||:|.:||:||:|||||.|||.|||||||||||||..|:       |
Zfish   174 CFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQHQAIG 238

  Fly   282 STDKQHLDSSSDSEMEGSMLPSQSA 306
            ....:.|..|..:....:..||.:|
Zfish   239 QNGMRSLSESGCAPRSSAESPSTAA 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soNP_476733.1 SIX1_SD 103..212 CDD:293483 70/112 (63%)
homeodomain 223..274 CDD:238039 35/50 (70%)
six3aNP_571437.1 SIX1_SD 49..162 CDD:293483 70/112 (63%)
homeodomain 170..218 CDD:238039 29/47 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X333
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.