DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment so and six9

DIOPT Version :9

Sequence 1:NP_476733.1 Gene:so / 35662 FlyBaseID:FBgn0003460 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001124080.1 Gene:six9 / 30623 ZFINID:ZDB-GENE-990621-11 Length:235 Species:Danio rerio


Alignment Length:228 Identity:140/228 - (61%)
Similarity:160/228 - (70%) Gaps:12/228 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 SFGFTQEQVACVCEVLQQAGNIERLGRFLWSLPQCDKL--------QLNESVLKAKAVVAFHRGQ 156
            :.||:.||||||||||.|:|:::||..||.|||.....        |..||||||:|.||||..:
Zfish     2 AMGFSPEQVACVCEVLLQSGSMDRLSSFLCSLPSISTSSNMYMGFGQSQESVLKARAAVAFHHCR 66

  Fly   157 YKELYRLLEHHHFSAQNHAKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEET 221
            :.|||.|||.:.||.::|..||.|||:|||:|||..||||||||||||:||||||||||||||||
Zfish    67 FTELYALLEGNVFSPRSHPLLQQLWLRAHYMEAELQRGRPLGAVGKYRIRRKFPLPRTIWDGEET 131

  Fly   222 SYCFKEKSRSVLRDWYSHNPYPSPREKRDLAEATGLTTTQVSNWFKNRRQRDRAAEHKDGSTDKQ 286
            |||||||||||||:||...||||||||||||.|||||.|||||||||||||||||..:.|::...
Zfish   132 SYCFKEKSRSVLREWYCRKPYPSPREKRDLAAATGLTATQVSNWFKNRRQRDRAATSRQGTSAGA 196

  Fly   287 HLDSSSDSEMEGSMLPSQSAQHQQQQQQQQHSP 319
            .|.|..:....||.....|.    .||...|.|
Zfish   197 FLSSDEEISPPGSPRTLFSC----SQQLSAHPP 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soNP_476733.1 SIX1_SD 103..212 CDD:293483 69/116 (59%)
homeodomain 223..274 CDD:238039 44/50 (88%)
six9NP_001124080.1 SIX1_SD 5..122 CDD:293483 69/116 (59%)
homeodomain 133..184 CDD:238039 44/50 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001063
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X333
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.