DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment so and Six4

DIOPT Version :9

Sequence 1:NP_476733.1 Gene:so / 35662 FlyBaseID:FBgn0003460 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_006240269.1 Gene:Six4 / 299138 RGDID:1306726 Length:775 Species:Rattus norvegicus


Alignment Length:366 Identity:159/366 - (43%)
Similarity:198/366 - (54%) Gaps:58/366 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SPTGLSGSVALHNNNNNNSSTSNNNNSTLDIMAHNGGGAGGGL-------------HLNSSSNGG 81
            ||||...|.|.....|...|.|....:..::    .|||..||             ...::|...
  Rat     5 SPTGQIASAADIKQENGMESASEGQEAHREV----AGGAAAGLSPPAPAPFPLEPGDAAAASRVS 65

  Fly    82 GGGGVVSGGGSG---------GREN-----LPSFGFTQEQVACVCEVLQQAGNIERLGRFLWSLP 132
            ...|..:.|.:.         ||..     .|...|:.:.||||||.|||.||::||.|||||||
  Rat    66 REEGAAAAGAADQVQLHSELLGRHQHAATAQPPLAFSPDHVACVCEALQQGGNLDRLARFLWSLP 130

  Fly   133 QCDKLQLNESVLKAKAVVAFHRGQYKELYRLLEHHHFSAQNHAKLQALWLKAHYVEAEKLRGRPL 197
            |.|.|:.|||:|||:|:||||:|.|.|||.:||.|.|.:.||..||.||.||.|.|||:.|||||
  Rat   131 QSDLLRGNESLLKARALVAFHQGIYPELYSILESHSFESANHPLLQQLWYKARYTEAERARGRPL 195

  Fly   198 GAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYSHNPYPSPREKRDLAEATGLTTTQV 262
            |||.|||:||||||||||||||||.||||||||:.|::.|..|.||||.|||.||:.|||:.|||
  Rat   196 GAVDKYRLRRKFPLPRTIWDGEETVYCFKEKSRNALKELYKQNRYPSPAEKRHLAKITGLSLTQV 260

  Fly   263 SNWFKNRRQRDRAAEHKDGSTDKQHLDSSSDSEMEGSMLPSQSAQHQQQQQQQQHSPGNSSGNNN 327
            ||||||||||||...           ::.|.||.:|    :.|.:.:..:..:..||...||.::
  Rat   261 SNWFKNRRQRDRNPS-----------ETQSKSESDG----NPSTEDESSKGHEDLSPHPLSGASD 310

  Fly   328 GLHQQQL-QHVAAEQGLQHHPHQPHPASNIANVAATKSSGG 367
            |:....| .|:           :|.....|.|...:.||.|
  Rat   311 GVTNLSLSSHM-----------EPVYMQQIGNAKISLSSSG 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soNP_476733.1 SIX1_SD 103..212 CDD:293483 72/108 (67%)
homeodomain 223..274 CDD:238039 36/50 (72%)
Six4XP_006240269.1 SIX1_SD 101..210 CDD:293483 72/108 (67%)
homeodomain 221..275 CDD:238039 38/53 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.