DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment so and Six1

DIOPT Version :9

Sequence 1:NP_476733.1 Gene:so / 35662 FlyBaseID:FBgn0003460 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_033215.2 Gene:Six1 / 20471 MGIID:102780 Length:284 Species:Mus musculus


Alignment Length:271 Identity:177/271 - (65%)
Similarity:198/271 - (73%) Gaps:27/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LPSFGFTQEQVACVCEVLQQAGNIERLGRFLWSLPQCDKLQLNESVLKAKAVVAFHRGQYKELYR 162
            ||||||||||||||||||||.||:|||||||||||.||.|..||||||||||||||||.::|||:
Mouse     4 LPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYK 68

  Fly   163 LLEHHHFSAQNHAKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKE 227
            :||.|.||..||.|||.||||||||||||||||||||||||||||||||||||||||||||||||
Mouse    69 ILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKE 133

  Fly   228 KSRSVLRDWYSHNPYPSPREKRDLAEATGLTTTQVSNWFKNRRQRDRAAEHKDGSTDKQHLDSSS 292
            |||.|||:||:|||||||||||:|||||||||||||||||||||||||||.|:....:   :::|
Mouse   134 KSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERENTE---NNNS 195

  Fly   293 DSEMEGSMLPSQSAQHQQQQQQQQHSPGNSSGNNN-------------------GLHQQQLQHVA 338
            .|..:..:.|.:..:......:::.||..|...|:                   ||...|..|  
Mouse   196 SSNKQNQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLLQSNMGHARSSNYSLPGLTASQPSH-- 258

  Fly   339 AEQGLQHHPHQ 349
               |||.|.||
Mouse   259 ---GLQAHQHQ 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soNP_476733.1 SIX1_SD 103..212 CDD:293483 91/108 (84%)
homeodomain 223..274 CDD:238039 46/50 (92%)
Six1NP_033215.2 SIX1_SD 9..118 CDD:407119 91/108 (84%)
homeodomain 129..180 CDD:238039 46/50 (92%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 168..284 34/107 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843016
Domainoid 1 1.000 200 1.000 Domainoid score I3033
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4360
Inparanoid 1 1.050 354 1.000 Inparanoid score I2235
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001063
OrthoInspector 1 1.000 - - otm43433
orthoMCL 1 0.900 - - OOG6_106461
Panther 1 1.100 - - O PTHR10390
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4764
SonicParanoid 1 1.000 - - X333
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.780

Return to query results.
Submit another query.