DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment so and ceh-33

DIOPT Version :9

Sequence 1:NP_476733.1 Gene:so / 35662 FlyBaseID:FBgn0003460 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_504420.1 Gene:ceh-33 / 191622 WormBaseID:WBGene00000454 Length:261 Species:Caenorhabditis elegans


Alignment Length:223 Identity:122/223 - (54%)
Similarity:160/223 - (71%) Gaps:15/223 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 FTQEQVACVCEVLQQAGNIERLGRFLWSLPQCDKLQLNESVLKAKAVVAFHRGQYKELYRLLEHH 167
            :::|||||:||.|  :.:..:|.:|:|::.:.|:::.|:.:|||:|.:|||...:|||||::|.|
 Worm    20 YSEEQVACICEAL--SNDARKLSQFVWTVLERDEMRNNQYILKAQAFLAFHSNNFKELYRIIESH 82

  Fly   168 HFSAQNHAKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRSV 232
            ||::::|..||..||.|||.||||:|||.||||||||:|||:||||||||||||||||::|||.:
 Worm    83 HFASEHHLPLQEWWLNAHYHEAEKIRGRQLGAVGKYRIRRKYPLPRTIWDGEETSYCFRDKSRVL 147

  Fly   233 LRDWYSHNPYPSPREKRDLAEATGLTTTQVSNWFKNRRQRDRAA--EHKDGSTDKQHLDSSSDSE 295
            |||||..|.||||||||:|||.|.||.||||||||||||||||.  |.||...|        .||
 Worm   148 LRDWYCRNSYPSPREKRELAEKTHLTVTQVSNWFKNRRQRDRAGVPEPKDCLKD--------ISE 204

  Fly   296 MEGSMLPSQSAQHQQQQQQQQHSPGNSS 323
            .|...|..::|   .:.....|:|.:.|
 Worm   205 EEDLKLIRKTA---SKLSNSFHNPSDLS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soNP_476733.1 SIX1_SD 103..212 CDD:293483 56/108 (52%)
homeodomain 223..274 CDD:238039 39/50 (78%)
ceh-33NP_504420.1 SIX1_SD 20..127 CDD:293483 56/108 (52%)
homeodomain 138..189 CDD:238039 39/50 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 137 1.000 Domainoid score I3037
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001063
OrthoInspector 1 1.000 - - oto18304
orthoMCL 1 0.900 - - OOG6_106461
Panther 1 1.100 - - O PTHR10390
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4764
SonicParanoid 1 1.000 - - X333
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.800

Return to query results.
Submit another query.